Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT92WJE6)

• DOT Name: Protein FAM53A (FAM53A)
• Synonyms: Dorsal neural-tube nuclear protein
• Gene Name: FAM53A
• Related Disease:
  Breast cancer
  Breast carcinoma
  Neoplasm
  Osteoarthritis
  Gout
• UniProt ID: FA53A_HUMAN
• Pfam ID: PF15242
• Sequence:
  MVTLITEKLQSQSLDDLTCKAEAGPLQYSAETLNKSGRLFPLELNDQSPWKVFSGGPPVR
  SQAATGPDFSFLPGLSAAAHTMGLQWQPQSPRPGAGLGAASTVDPSESTGSSTAPPTKRH
  CRSLSEPEELVRCRSPWRPGSSKVWTPVSKRRCDSGGSATRQGSPGAVLPRSAVWSTGPT
  SPATPRPSSASGGFVDSSEGSAGSGPLWCSAESCLPSTRRRPSLSQERLAGAGTPLPWAS
  SSPTSTPALGGRRGLLRCRSQPCVLSGKRSRRKRRREEDARWTRPSLDFLKMTQTLKNSK
  SLCSLNYEDDDEDDTPVKTVLSSPCDSRGLPGITMPGCSQRGLRTSPVHPNLWASRESVT
  SDGSRRSSGDPRDGDSVGEEGVFPRARWELDLEQIENN
• Function: May play an important role in neural development; the dorsomedial roof of the third ventricle.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Osteoarthritis	DIS05URM	Strong	Genetic Variation	[2]
Gout	DISHC0U7	Limited	Genetic Variation	[3]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein FAM53A (FAM53A).	[4]
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Protein FAM53A (FAM53A).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Protein FAM53A (FAM53A).	[8]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein FAM53A (FAM53A).	[5]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Protein FAM53A (FAM53A).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein FAM53A (FAM53A).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Protein FAM53A (FAM53A).	[10]

References

• [1] FAM53A Affects Breast Cancer Cell Proliferation, Migration, and Invasion in a p53-Dependent Manner.Front Oncol. 2019 Nov 14;9:1244. doi: 10.3389/fonc.2019.01244. eCollection 2019.
• [2] Identification of new therapeutic targets for osteoarthritis through genome-wide analyses of UK Biobank data. Nat Genet. 2019 Feb;51(2):230-236.
• [3] Genome-wide association study revealed novel loci which aggravate asymptomatic hyperuricaemia into gout.Ann Rheum Dis. 2019 Oct;78(10):1430-1437. doi: 10.1136/annrheumdis-2019-215521. Epub 2019 Jul 8.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [6] Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
• [7] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.