Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9IEBRD)

• DOT Name: Ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1)
• Synonyms: GDAP1-L1
• Gene Name: GDAP1L1
• Related Disease: Non-insulin dependent diabetes
• UniProt ID: GD1L1_HUMAN
• Pfam ID: PF13410 ; PF13409
• Sequence:
  MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQK
  VRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVER
  TFTGEHVVALMPEVGSLQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAE
  IRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQ
  IEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQS
  FFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYW
  YLKKKYI

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1).	[2]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1).	[3]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1).	[4]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1).	[6]

References

• [1] Genome-wide association study in individuals of South Asian ancestry identifies six new type 2 diabetes susceptibility loci.Nat Genet. 2011 Aug 28;43(10):984-9. doi: 10.1038/ng.921.
• [2] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [3] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [4] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [5] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.