Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9L6DLK)

• DOT Name: Complement C1q-like protein 4 (C1QL4)
• Synonyms: C1q and tumor necrosis factor-related protein 11; C1q/TNF-related protein 11
• Gene Name: C1QL4
• UniProt ID: C1QL4_HUMAN
• Pfam ID: PF00386
• Sequence:
  MVLLLLVAIPLLVHSSRGPAHYEMLGRCRMVCDPHGPRGPGPDGAPASVPPFPPGAKGEV
  GRRGKAGLRGPPGPPGPRGPPGEPGRPGPPGPPGPGPGGVAPAAGYVPRIAFYAGLRRPH
  EGYEVLRFDDVVTNVGNAYEAASGKFTCPMPGVYFFAYHVLMRGGDGTSMWADLMKNGQV
  RASAIAQDADQNYDYASNSVILHLDVGDEVFIKLDGGKVHGGNTNKYSTFSGFIIYPD
• Function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. May inhibit adipocyte differentiation at an early stage of the process.
• Tissue Specificity: Highest expression levels in testis and adipose tissue, lower levels in skeletal muscle and kidney.

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Complement C1q-like protein 4 (C1QL4).	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Complement C1q-like protein 4 (C1QL4).	[2]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Complement C1q-like protein 4 (C1QL4).	[3]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Complement C1q-like protein 4 (C1QL4).	[4]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Complement C1q-like protein 4 (C1QL4).	[5]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Complement C1q-like protein 4 (C1QL4).	[6]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Complement C1q-like protein 4 (C1QL4).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Complement C1q-like protein 4 (C1QL4).	[8]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Complement C1q-like protein 4 (C1QL4).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [4] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [5] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [6] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [9] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.