Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9NKWFW)

DOT Name	Leucine-rich repeat-containing protein 10B (LRRC10B)
Gene Name	LRRC10B
Related Disease	High blood pressure ( )
UniProt ID	LR10B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13855
Sequence	MGIAESTPDELPSDAEEQLRSGDQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELP EEIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFAQLQSLRCLWI EGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLR MGRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPPRVADTVFLVGEGAVERMAER DEPTPRPPPRRPARAFEDEEEEDLLIGGAGSRALGAPGGSFRALEAAPGLGT

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
High blood pressure	DISY2OHH	Strong	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Leucine-rich repeat-containing protein 10B (LRRC10B).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Leucine-rich repeat-containing protein 10B (LRRC10B).	[5]
------------------------------------------------------------------------------------

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Leucine-rich repeat-containing protein 10B (LRRC10B).	[3]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Leucine-rich repeat-containing protein 10B (LRRC10B).	[4]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Leucine-rich repeat-containing protein 10B (LRRC10B).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Leucine-rich repeat-containing protein 10B (LRRC10B).	[6]
------------------------------------------------------------------------------------

References

1	Interethnic analyses of blood pressure loci in populations of East Asian and European descent.Nat Commun. 2018 Nov 28;9(1):5052. doi: 10.1038/s41467-018-07345-0.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
4	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6	Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.