Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9Q0IM2)

• DOT Name: Ciliary microtubule associated protein 1B (CIMAP1B)
• Synonyms: Outer dense fiber protein 3-like protein 3; Outer dense fiber protein 3B
• Gene Name: CIMAP1B
• UniProt ID: CMA1B_HUMAN
• Pfam ID: PF07004
• Sequence:
  MGSDAWVGLWRPHRPRGPIAAHYGGPGPKYKLPPNTGYALHDPSRPRAPAFTFGARFPTQ
  QTTCGPGPGHLVPARMTVRGTDGAPAYSIYGRPRRSAPFLTPGPGRYFPERAGNATYPSA
  PRHTIAPRNWGVQAEQQSPGPAAYTVPSLLGPRVIGKVSAPTCSIYGRRAAGSFFEDLSK
  TPGPCAYQVVSPGVYKSRAPQFTILARTSLPQDNTRKPGPAAYNVDQHRKPRGWSFGIRH
  SDYLAPLVTDADN

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ciliary microtubule associated protein 1B (CIMAP1B).	[1]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Ciliary microtubule associated protein 1B (CIMAP1B).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Ciliary microtubule associated protein 1B (CIMAP1B).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Ciliary microtubule associated protein 1B (CIMAP1B).	[4]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Ciliary microtubule associated protein 1B (CIMAP1B).	[5]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Ciliary microtubule associated protein 1B (CIMAP1B).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Ciliary microtubule associated protein 1B (CIMAP1B).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Ciliary microtubule associated protein 1B (CIMAP1B).	[8]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.