Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9XQFL5)

• DOT Name: Immunoglobulin lambda-like polypeptide 5 (IGLL5)
• Synonyms: G lambda-1; Germline immunoglobulin lambda 1
• Gene Name: IGLL5
• Related Disease:
  Disease of orbital part of eye adnexa
  Mantle cell lymphoma
  Neoplasm
  Small lymphocytic lymphoma
  Systemic lupus erythematosus
  Plasma cell myeloma
  Lymphoma
  Neurofibromatosis type 2
• UniProt ID: IGLL5_HUMAN
• PDB ID: 7T17
• Pfam ID: PF07654
• Sequence:
  MRPKTGQVGCETPEELGPGPRQRWPLLLLGLAMVAHGLLRPMVAPQSGDPDPGASVGSSR
  SSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLF
  PPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYL
  SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
• Tissue Specificity: Contrary to IGLL1, not expressed in pre-B-cells.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Disease of orbital part of eye adnexa	DISGWPWX	Strong	Genetic Variation	[1]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[3]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[4]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[5]
Plasma cell myeloma	DIS0DFZ0	moderate	Genetic Variation	[6]
Lymphoma	DISN6V4S	Limited	Altered Expression	[7]
Neurofibromatosis type 2	DISI8ECS	Limited	Genetic Variation	[8]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coprexa	DMA0WEK	Phase 3	Coprexa increases the expression of Immunoglobulin lambda-like polypeptide 5 (IGLL5).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Immunoglobulin lambda-like polypeptide 5 (IGLL5).	[10]

References

• [1] Biased immunoglobulin light chain use in the Chlamydophila psittaci negative ocular adnexal marginal zone lymphomas.Am J Hematol. 2013 May;88(5):379-84. doi: 10.1002/ajh.23416. Epub 2013 Mar 28.
• [2] Mantle cell lymphoma cell lines show no evident immunoglobulin heavy chain stereotypy but frequent light chain stereotypy.Leuk Lymphoma. 2013 Aug;54(8):1747-55. doi: 10.3109/10428194.2012.758843. Epub 2013 Jan 23.
• [3] Lineage-negative lymphoma with a helper innate lymphoid cell phenotype.Virchows Arch. 2020 Feb;476(2):285-293. doi: 10.1007/s00428-019-02658-x. Epub 2019 Sep 14.
• [4] Evidence for the significant role of immunoglobulin light chains in antigen recognition and selection in chronic lymphocytic leukemia.Blood. 2009 Jan 8;113(2):403-11. doi: 10.1182/blood-2008-07-166868. Epub 2008 Oct 23.
• [5] Immunoglobulin V-lambda transcription profiling of systemic lupus erythematosus patients reveals biased usage of genes located near the Jlambda-Clambda segments.Scand J Immunol. 2004 Apr;59(4):395-9. doi: 10.1111/j.0300-9475.2004.01407.x.
• [6] A multiple myeloma-specific capture sequencing platform discovers novel translocations and frequent, risk-associated point mutations in IGLL5.Blood Cancer J. 2018 Mar 21;8(3):35. doi: 10.1038/s41408-018-0062-y.
• [7] Branched-chain in situ hybridization for and light chains: A powerful ancillary technique for determining B-cell clonality in cytology samples.Cancer Cytopathol. 2016 Mar;124(3):203-12. doi: 10.1002/cncy.21629. Epub 2015 Nov 2.
• [8] Neurofibromatosis 2: clinical and DNA linkage studies of a large kindred.N Engl J Med. 1988 Aug 4;319(5):278-83. doi: 10.1056/NEJM198808043190505.
• [9] Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
• [10] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.