Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9YGK94)

DOT Name Bromo adjacent homology domain-containing 1 protein (BAHD1)
Synonyms BAH domain-containing protein 1
Gene Name BAHD1
Related Disease
Childhood acute lymphoblastic leukemia ( )
Listeriosis ( )
Ulcerative colitis ( )
UniProt ID
BAHD1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01426
Sequence
MTHTRRKSLPMLSSGLTGRREPLQMEDSNMEQGVEGVEPGMPESPGHLTGRRKNYPLRKR
PLVPEKPKACKVLLTRLENVAGPRSADEADELPPDLPKPPSPAPSSEDPGLAQPRKRRLA
SLNAEALNNLLLEREDTSSLAGTRRSRAGDPHRSRDRDRATGGWSSSKKRPRLGDLGGGS
RDLSPEPAPDEGPRRDGDPAPKRLASLNAAAFLKLSQERELPLRLPRAHAEVDGRSTEPP
APKAPRPKWPKVNGKNYPKAWQGASSGEAAGPPGWQGCPDEPWPSATPCGPSVQPSHQPL
SKALESPLGLRPHLPLLMGGQAALKPEPGRPGEESPAPKQELHQPSFPTPQLSPLPMPGN
PADYNGLCVGPELTALGSFYLYCGQEGLQCGGYSPCPMLPEGKLSPVAAPHEEGLLLAPS
SVPSGTPFQHPPWGSSRYCSSEDTGVNGYSICGVLPLSVTHAGTTCGGCPYKMPFAAEGC
RSLGQLEFPLPEAGHPASPAHPLLGCPVPSVPPAAEPVPHLQTPTSEPQTVARACPQSAK
PPSGSKSGLRTGSSCRHTARSKAARRPSHPKQPRVQRPRPRRRRRRRTNGWVPVGAACEK
AVYVLDEPEPAIRKSYQAVERHGETIRVRDTVLLKSGPRKTSTPYVAKISALWENPESGE
LMMSLLWYYRPEHLQGGRSPSMHEPLQNEVFASRHQDQNSVACIEEKCYVLTFAEYCRFC
AMAKRRGEGLPSRKTALVPPSADYSTPPHRTVPEDTDPELVFLCRHVYDFRHGRILKNPQ
Function
Heterochromatin protein that acts as a transcription repressor and has the ability to promote the formation of large heterochromatic domains. May act by recruiting heterochromatin proteins such as CBX5 (HP1 alpha), HDAC5 and MBD1. Represses IGF2 expression by binding to its CpG-rich P3 promoter and recruiting heterochromatin proteins. At specific stages of Listeria infection, in complex with TRIM28, corepresses interferon-stimulated genes, including IFNL1, IFNL2 and IFNL3.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Genetic Variation [1]
Listeriosis DISKMQBM Strong Biomarker [2]
Ulcerative colitis DIS8K27O Strong Biomarker [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Bromo adjacent homology domain-containing 1 protein (BAHD1). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Bromo adjacent homology domain-containing 1 protein (BAHD1). [11]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Bromo adjacent homology domain-containing 1 protein (BAHD1). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Bromo adjacent homology domain-containing 1 protein (BAHD1). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Bromo adjacent homology domain-containing 1 protein (BAHD1). [7]
Menadione DMSJDTY Approved Menadione affects the expression of Bromo adjacent homology domain-containing 1 protein (BAHD1). [8]
Acocantherin DM7JT24 Approved Acocantherin decreases the expression of Bromo adjacent homology domain-containing 1 protein (BAHD1). [9]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Bromo adjacent homology domain-containing 1 protein (BAHD1). [10]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Bromo adjacent homology domain-containing 1 protein (BAHD1). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Genetic risk factors for VIPN in childhood acute lymphoblastic leukemia patients identified using whole-exome sequencing.Pharmacogenomics. 2018 Oct;19(15):1181-1193. doi: 10.2217/pgs-2018-0093. Epub 2018 Sep 7.
2 A bacterial protein targets the BAHD1 chromatin complex to stimulate type III interferon response.Science. 2011 Mar 11;331(6022):1319-21. doi: 10.1126/science.1200120. Epub 2011 Jan 20.
3 Computational Prediction and Validation of BAHD1 as a Novel Molecule for Ulcerative Colitis.Sci Rep. 2015 Jul 17;5:12227. doi: 10.1038/srep12227.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
9 Ouabain at pathological concentrations might induce damage in human vascular endothelial cells. Acta Pharmacol Sin. 2006 Feb;27(2):165-72. doi: 10.1111/j.1745-7254.2006.00244.x.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.