Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9YXMIL)

• DOT Name: Lipocalin-15 (LCN15)
• Gene Name: LCN15
• UniProt ID: LCN15_HUMAN
• PDB ID: 2XST
• Pfam ID: PF00061
• Sequence:
  MMSFLLGAILTLLWAPTAQAEVLLQPDFNAEKFSGLWYVVSMASDCRVFLGKKDHLSMST
  RAIRPTEEGGLHVHMEFPGADGCNQVDAEYLKVGSEGHFRVPALGYLDVRIVDTDYSSFA
  VLYIYKELEGALSTMVQLYSRTQDVSPQALKSFQDFYPTLGLPKDMMVMLPQSDACNPES
  KEAP
• Reactome Pathway: Transport of fatty acids (R-HSA-804914)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Lipocalin-15 (LCN15).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Lipocalin-15 (LCN15).	[8]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Lipocalin-15 (LCN15).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Lipocalin-15 (LCN15).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Lipocalin-15 (LCN15).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Lipocalin-15 (LCN15).	[5]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Lipocalin-15 (LCN15).	[6]
Ampicillin	DMHWE7P	Approved	Ampicillin increases the expression of Lipocalin-15 (LCN15).	[5]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 decreases the expression of Lipocalin-15 (LCN15).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Lipocalin-15 (LCN15).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Lipocalin-15 (LCN15).	[10]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of Lipocalin-15 (LCN15).	[5]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE decreases the expression of Lipocalin-15 (LCN15).	[11]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [7] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [11] Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.