Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTA8LWSL)

• DOT Name: Annexin A10 (ANXA10)
• Synonyms: Annexin-10; Annexin-14
• Gene Name: ANXA10
• UniProt ID: ANX10_HUMAN
• Pfam ID: PF00191
• Sequence:
  MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQ
  SMYGRDLIGDMREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRT
  NGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVL
  WEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINECYDGYFQELLVA
  IVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEIDLLTIRKRYKERYGKSLFHD
  IRNFASGHYKKALLAICAGDAEDY

Molecular Interaction Atlas (MIA) of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Annexin A10 (ANXA10).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Annexin A10 (ANXA10).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Annexin A10 (ANXA10).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Annexin A10 (ANXA10).	[2]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Annexin A10 (ANXA10).	[4]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Annexin A10 (ANXA10).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Annexin A10 (ANXA10).	[2]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Annexin A10 (ANXA10).	[5]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Annexin A10 (ANXA10).	[7]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos increases the expression of Annexin A10 (ANXA10).	[8]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Annexin A10 (ANXA10).	[9]
NSC-1771	DMNXDGQ	Investigative	NSC-1771 increases the expression of Annexin A10 (ANXA10).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Annexin A10 (ANXA10).	[6]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [5] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [7] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [8] RNA-protein correlation of liver toxicity markers in HepaRG cells. EXCLI J. 2020 Jan 17;19:135-153. doi: 10.17179/excli2019-2005. eCollection 2020.
• [9] The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.