Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAFZHY9)

• DOT Name: Protein FAM219A (FAM219A)
• Gene Name: FAM219A
• UniProt ID: F219A_HUMAN
• Pfam ID: PF15260
• Sequence:
  MMEEIDRFQVPTAHSEMQPLDPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELA
  RKGSLKNGSMGSPVNQQPKKNNVMARTRLVVPNKGYSSLDQSPDEKPLVALDTDSDDDFD
  MSRYSSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCCQATSST
  ACHIQ

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein FAM219A (FAM219A).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein FAM219A (FAM219A).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein FAM219A (FAM219A).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Protein FAM219A (FAM219A).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Protein FAM219A (FAM219A).	[2]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Protein FAM219A (FAM219A).	[5]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Protein FAM219A (FAM219A).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Protein FAM219A (FAM219A).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Protein FAM219A (FAM219A).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [6] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.