Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAGSWMH)

• DOT Name: Regulator of G-protein signaling 7-binding protein (RGS7BP)
• Synonyms: R7 family-binding protein
• Gene Name: RGS7BP
• Related Disease: Asthma
• UniProt ID: R7BP_HUMAN
• Sequence:
  MSSAPNGRKKRPSRSTRSSIFQISKPPLQSGDWERRGSGSESAHKTQRALDDCKMLVQEF
  NTQVALYRELVISIGDVSVSCPSLRAEMHKTRTKGCEMARQAHQKLAAISGPEDGEIHPE
  ICRLYIQLQCCLEMYTTEMLKSICLLGSLQFHRKGKEPGGGTKSLDCKIEESAETPALED
  SSSSPVDSQQHSWQVSTDIENTERDMREMKNLLSKLRETMPLPLKNQDDSSLLNLTPYPL
  VRRRKRRFFGLCCLISS
• Function: Regulator of G protein-coupled receptor (GPCR) signaling. Regulatory subunit of the R7-Gbeta5 complexes that acts by controlling the subcellular location of the R7-Gbeta5 complexes. When palmitoylated, it targets the R7-Gbeta5 complexes to the plasma membrane, leading to inhibit G protein alpha subunits. When it is unpalmitoylated, the R7-Gbeta5 complexes undergo a nuclear/cytoplasmic shuttling. May also act by controlling the proteolytic stability of R7 proteins, probably by protecting them from degradation.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Asthma	DISW9QNS	Strong	Genetic Variation	[1]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Aspirin	DM672AH	Approved	Regulator of G-protein signaling 7-binding protein (RGS7BP) affects the response to substance of Aspirin.	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Regulator of G-protein signaling 7-binding protein (RGS7BP).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Regulator of G-protein signaling 7-binding protein (RGS7BP).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Regulator of G-protein signaling 7-binding protein (RGS7BP).	[5]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Regulator of G-protein signaling 7-binding protein (RGS7BP).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Regulator of G-protein signaling 7-binding protein (RGS7BP).	[6]

References

• [1] Association analysis of RGS7BP gene polymorphisms with aspirin intolerance in asthmatic patients. Ann Allergy Asthma Immunol. 2011 Apr;106(4):292-300.e6. doi: 10.1016/j.anai.2010.10.021. Epub 2011 Jan 8.
• [2] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [7] Association analysis of RGS7BP gene polymorphisms with aspirin intolerance in asthmatic patients. Ann Allergy Asthma Immunol. 2011 Apr;106(4):292-300.e6. doi: 10.1016/j.anai.2010.10.021. Epub 2011 Jan 8.