Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTARRSWB)

• DOT Name: Sorting nexin-12 (SNX12)
• Gene Name: SNX12
• Related Disease:
  Alzheimer disease
  Amyloidosis
• UniProt ID: SNX12_HUMAN
• PDB ID: 2CSK
• Pfam ID: PF00787
• Sequence:
  MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPI
  FKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERR
  QGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ
• Function: May be involved in several stages of intracellular trafficking.
• KEGG Pathway: Endocytosis (hsa04144)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Altered Expression	[1]
Amyloidosis	DISHTAI2	Strong	Biomarker	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Sorting nexin-12 (SNX12).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Sorting nexin-12 (SNX12).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Sorting nexin-12 (SNX12).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Sorting nexin-12 (SNX12).	[5]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Sorting nexin-12 (SNX12).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Sorting nexin-12 (SNX12).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Sorting nexin-12 (SNX12).	[9]
GALLICACID	DM6Y3A0	Investigative	GALLICACID increases the expression of Sorting nexin-12 (SNX12).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Sorting nexin-12 (SNX12).	[7]

References

• [1] Sorting nexin 12 interacts with BACE1 and regulates BACE1-mediated APP processing.Mol Neurodegener. 2012 Jun 18;7:30. doi: 10.1186/1750-1326-7-30.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [6] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [10] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.