Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB0OEQN)

• DOT Name: RNA-binding protein MEX3A (MEX3A)
• Synonyms: RING finger and KH domain-containing protein 4
• Gene Name: MEX3A
• Related Disease:
  Bladder transitional cell carcinoma
  Bladder cancer
• UniProt ID: MEX3A_HUMAN
• Pfam ID: PF00013 ; PF13920
• Sequence:
  MPSLVVSGIMERNGGFGELGCFGGSAKDRGLLEDERALQLALDQLCLLGLGEPPAPTAGE
  DGGGGGGGAPAQPAAPPQPAPPPPPAAPPAAPTAAPAAQTPQPPTAPKGASDAKLCALYK
  EAELRLKGSSNTTECVPVPTSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFMVT
  GRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALPGQVTIRVRVPYRVVGLVVG
  PKGATIKRIQQQTNTYIITPSRDRDPVFEITGAPGNVERAREEIETHIAVRTGKILEYNN
  ENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCIGECGVDSGFEAPRLGEQG
  GDFGYGGYLFPGYGVGKQDVYYGVAETSPPLWAGQENATPTSVLFSSASSSSSSSAKARA
  GPPGAHRSPATSAGPELAGLPRRPPGEPLQGFSKLGGGGLRSPGGGRDCMVCFESEVTAA
  LVPCGHNLFCMECAVRICERTDPECPVCHITATQAIRIFS
• Function: RNA binding protein, may be involved in post-transcriptional regulatory mechanisms.
• Tissue Specificity: Highest levels found in fetal brain and testis. Detected also in thymus, salivary gland and uterus.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bladder transitional cell carcinoma	DISNL46A	Definitive	Altered Expression	[1]
Bladder cancer	DISUHNM0	Strong	Biomarker	[2]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of RNA-binding protein MEX3A (MEX3A).	[3]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of RNA-binding protein MEX3A (MEX3A).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of RNA-binding protein MEX3A (MEX3A).	[5]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of RNA-binding protein MEX3A (MEX3A).	[4]
Marinol	DM70IK5	Approved	Marinol increases the expression of RNA-binding protein MEX3A (MEX3A).	[6]
Melphalan	DMOLNHF	Approved	Melphalan increases the expression of RNA-binding protein MEX3A (MEX3A).	[7]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of RNA-binding protein MEX3A (MEX3A).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of RNA-binding protein MEX3A (MEX3A).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of RNA-binding protein MEX3A (MEX3A).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of RNA-binding protein MEX3A (MEX3A).	[8]

References

• [1] Mex3a expression and survival analysis of bladder urothelial carcinoma.Oncotarget. 2017 Jun 7;8(33):54764-54774. doi: 10.18632/oncotarget.18399. eCollection 2017 Aug 15.
• [2] Identification of hMex-3A and its effect on human bladder cancer cell proliferation.Oncotarget. 2017 May 22;8(37):61215-61225. doi: 10.18632/oncotarget.18050. eCollection 2017 Sep 22.
• [3] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [4] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [7] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.