Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBDYJMT)

DOT Name Putative protein N-methyltransferase FAM86B1 (FAM86B1)
Synonyms EC 2.1.1.-
Gene Name FAM86B1
UniProt ID
F86B1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.1.1.-
Pfam ID
PF14904 ; PF10294
Sequence
MAPEENAGTELLLQGFERRFLAVRTLRSFPWQSLEAKLRDSSDSELLRDILQKTVRHPVC
VKHPPSVKYAWCFLSELIKKSSGGSVTLSKSTAIISHGTTGLVTWDAALYLAEWAIENPA
AFINRTVLELGSGAGLTGLAICKMCRPRAYIFSDPHSRVLEQLRGNVLLNGLSLEADITG
NLDSPRVTVAQLDWDVAMVHQLSAFQPDVVIAADVLYCPEAIVSLVGVLQRLAACREHKR
APEVYVAFTVRNPETCQLFTTELGRDGIRWEAEAHHDQKLFPYGEHLEMAMLNLTL

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Putative protein N-methyltransferase FAM86B1 (FAM86B1). [1]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Putative protein N-methyltransferase FAM86B1 (FAM86B1). [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Putative protein N-methyltransferase FAM86B1 (FAM86B1). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Putative protein N-methyltransferase FAM86B1 (FAM86B1). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Putative protein N-methyltransferase FAM86B1 (FAM86B1). [5]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Putative protein N-methyltransferase FAM86B1 (FAM86B1). [6]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Putative protein N-methyltransferase FAM86B1 (FAM86B1). [7]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Putative protein N-methyltransferase FAM86B1 (FAM86B1). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
3 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
7 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
8 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.