Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBK1QPN)

DOT Name Hydroxylysine kinase (HYKK)
Synonyms 5-hydroxy-L-lysine kinase; EC 2.7.1.81; Aminoglycoside phosphotransferase domain-containing protein 1
Gene Name HYKK
Related Disease
Lung adenocarcinoma ( )
Nasopharyngeal carcinoma ( )
Phosphohydroxylysinuria ( )
Schizophrenia ( )
Chronic obstructive pulmonary disease ( )
Lung cancer ( )
Lung carcinoma ( )
Inborn disorder of lysine and hydroxylysine metabolism ( )
UniProt ID
HYKK_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.7.1.81
Pfam ID
PF01636
Sequence
MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPT
EYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKS
YLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKN
VPLLEKYLYALGQNRNREIVEHVIHLFKEEVMTKLSHFRECINHGDLNDHNILIESSKSA
SGNAEYQVSGILDFGDMSYGYYVFEVAITIMYMMIESKSPIQVGGHVLAGFESITPLTAV
EKGALFLLVCSRFCQSLVMAAYSCQLYPENKDYLMVTAKTGWKHLQQMFDMGQKAVEEIW
FETAKSYESGISM
Function Catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine.
KEGG Pathway
Lysine degradation (hsa00310 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Lysine catabolism (R-HSA-71064 )

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lung adenocarcinoma DISD51WR Strong Biomarker [1]
Nasopharyngeal carcinoma DISAOTQ0 Strong Genetic Variation [2]
Phosphohydroxylysinuria DISYMHY8 Strong Genetic Variation [3]
Schizophrenia DISSRV2N Strong Genetic Variation [4]
Chronic obstructive pulmonary disease DISQCIRF Limited Genetic Variation [5]
Lung cancer DISCM4YA Limited Genetic Variation [6]
Lung carcinoma DISTR26C Limited Genetic Variation [6]
Inborn disorder of lysine and hydroxylysine metabolism DIS2XEJE No Known Unknown [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Hydroxylysine kinase (HYKK). [8]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Hydroxylysine kinase (HYKK). [9]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Hydroxylysine kinase (HYKK). [10]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Hydroxylysine kinase (HYKK). [12]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Hydroxylysine kinase (HYKK). [11]
------------------------------------------------------------------------------------

References

1 Transcription deregulation at the 15q25 locus in association with lung adenocarcinoma risk.Clin Cancer Res. 2009 Mar 1;15(5):1837-42. doi: 10.1158/1078-0432.CCR-08-2107. Epub 2009 Feb 17.
2 A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci.Nat Genet. 2010 Jul;42(7):599-603. doi: 10.1038/ng.601. Epub 2010 May 30.
3 Molecular identification of hydroxylysine kinase and of ammoniophospholyases acting on 5-phosphohydroxy-L-lysine and phosphoethanolamine.J Biol Chem. 2012 Mar 2;287(10):7246-55. doi: 10.1074/jbc.M111.323485. Epub 2012 Jan 12.
4 Genome-Wide Association Study Detected Novel Susceptibility Genes for Schizophrenia and Shared Trans-Populations/Diseases Genetic Effect.Schizophr Bull. 2019 Jun 18;45(4):824-834. doi: 10.1093/schbul/sby140.
5 The genetics of smoking in individuals with chronic obstructive pulmonary disease.Respir Res. 2018 Apr 10;19(1):59. doi: 10.1186/s12931-018-0762-7.
6 Genetic polymorphisms and lung cancer risk: Evidence from meta-analyses and genome-wide association studies.Lung Cancer. 2017 Nov;113:18-29. doi: 10.1016/j.lungcan.2017.08.026. Epub 2017 Sep 1.
7 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
8 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
9 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
10 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.