Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBN890H)

• DOT Name: Secernin-3 (SCRN3)
• Gene Name: SCRN3
• UniProt ID: SCRN3_HUMAN
• Pfam ID: PF03577
• Sequence:
  MEPFSCDTFVALPPATVDNRIIFGKNSDRLYDEVQEVVYFPAVVHDNLGERLKCTYIEID
  QVPETYAVVLSRPAWLWGAEMGANEHGVCIGNEAVWGREEVCDEEALLGMDLVRLGLERA
  DTAEKALNVIVDLLEKYGQGGNCTEGRMVFSYHNSFLIADRNEAWILETAGKYWAAEKVQ
  EGVRNISNQLSITTKIAREHPDMRNYAKRKGWWDGKKEFDFAAAYSYLDTAKMMTSSGRY
  CEGYKLLNKHKGNITFETMMEILRDKPSGINMEGEFLTTASMVSILPQDSSLPCIHFFTG
  TPDPERSVFKPFIFVPHISQLLDTSSPTFELEDLVKKKSHFKPDRRHPLYQKHQQALEVV
  NNNEEKAKIMLDNMRKLEKELFREMESILQNKHLDVEKIVNLFPQCTKDEIQIYQSNLSV
  KVSS

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Secernin-3 (SCRN3).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Secernin-3 (SCRN3).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Secernin-3 (SCRN3).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Secernin-3 (SCRN3).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Secernin-3 (SCRN3).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Secernin-3 (SCRN3).	[6]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Secernin-3 (SCRN3).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Secernin-3 (SCRN3).	[8]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Secernin-3 (SCRN3).	[9]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Secernin-3 (SCRN3).	[10]

References

• [1] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [2] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [6] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [7] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [8] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [9] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [10] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.