Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBQRU82)

• DOT Name: Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3)
• Synonyms: Keio novel protein-I; KNP-I; Protein GT335; Protein HES1
• Gene Name: GATD3
• UniProt ID: GAL3B_HUMAN
• Sequence:
  MAAVRALVASRLAAASAFTSLSPGGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEI
  HEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL
  ANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAP
  VLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTP
  AFMCETALHYIHDGIGAMVRKVLELTGK

Molecular Interaction Atlas (MIA) of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[4]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[5]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[6]
Sulindac	DM2QHZU	Approved	Sulindac decreases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[6]
Aminoglutethimide	DMWFHMZ	Approved	Aminoglutethimide increases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[7]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[8]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[11]
Celastrol	DMWQIJX	Preclinical	Celastrol decreases the expression of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial (GATD3).	[10]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [6] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [7] Proteomic profile of aminoglutethimide-induced apoptosis in HL-60 cells: role of myeloperoxidase and arylamine free radicals. Chem Biol Interact. 2015 Sep 5;239:129-38.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.