Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCM6DDO)

• DOT Name: Septin-14 (SEPTIN14)
• Gene Name: SEPTIN14
• Related Disease:
  Adult glioblastoma
  Gliosarcoma
  Glioblastoma multiforme
  Parkinson disease
• UniProt ID: SEP14_HUMAN
• PDB ID: 8SJJ
• Pfam ID: PF00735
• Sequence:
  MAERTMAMPTQIPADGDTQKENNIRCLTTIGHFGFECLPNQLVSRSIRQGFTFNILCVGE
  TGIGKSTLIDTLFNTNLKDNKSSHFYSNVGLQIQTYELQESNVQLKLTVVETVGYGDQID
  KEASYQPIVDYIDAQFEAYLQEELKIKRSLFEYHDSRVHVCLYFISPTGHSLKSLDLLTM
  KNLDSKVNIIPLIAKADTISKNDLQTFKNKIMSELISNGIQIYQLPTDEETAAQANSSVS
  GLLPFAVVGSTDEVKVGKRMVRGRHYPWGVLQVENENHCDFVKLRDMLLCTNMENLKEKT
  HTQHYECYRYQKLQKMGFTDVGPNNQPVSFQEIFEAKRQEFYDQCQREEEELKQRFMQRV
  KEKEATFKEAEKELQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQL
  STDTKKDKHRKK
• Function: Filament-forming cytoskeletal GTPase (Probable). Involved in the migration of cortical neurons and the formation of neuron leading processes during embryonic development. Plays a role in sperm head formation during spermiogenesis, potentially via facilitating localization of ACTN4 to cell filaments.
• Tissue Specificity: Testis-specific (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[1]
Gliosarcoma	DIS985MG	moderate	FusionGene	[2]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[1]
Parkinson disease	DISQVHKL	Limited	Biomarker	[3]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Septin-14 (SEPTIN14).	[4]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Septin-14 (SEPTIN14).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Septin-14 (SEPTIN14).	[6]

References

• [1] The integrated landscape of driver genomic alterations in glioblastoma.Nat Genet. 2013 Oct;45(10):1141-9. doi: 10.1038/ng.2734. Epub 2013 Aug 5.
• [2] Systematic exploration of natural and synthetic flavonoids for the inhibition of Staphylococcus aureus biofilms.Int J Mol Sci. 2013 Sep 25;14(10):19434-51. doi: 10.3390/ijms141019434.
• [3] SEPT14 Is Associated with a Reduced Risk for Parkinson's Disease and Expressed in Human Brain.J Mol Neurosci. 2016 Jul;59(3):343-50. doi: 10.1007/s12031-016-0738-3. Epub 2016 Apr 26.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.