Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCP868V)

DOT Name ADP-ribosylation factor-like protein 9 (ARL9)
Gene Name ARL9
Related Disease
Non-insulin dependent diabetes ( )
UniProt ID
ARL9_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00025
Sequence
MRPTWKALSHPAWPEEKNKQILVLGLDGAGKTSVLHSLASNRVQHSVAPTQGFHAVCINT
EDSQMEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLP
LVVFANKQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIA
QLAADVQ

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of ADP-ribosylation factor-like protein 9 (ARL9). [2]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of ADP-ribosylation factor-like protein 9 (ARL9). [3]
Triclosan DMZUR4N Approved Triclosan decreases the expression of ADP-ribosylation factor-like protein 9 (ARL9). [4]
Decitabine DMQL8XJ Approved Decitabine affects the expression of ADP-ribosylation factor-like protein 9 (ARL9). [3]
Testosterone Undecanoate DMZO10Y Approved Testosterone Undecanoate increases the expression of ADP-ribosylation factor-like protein 9 (ARL9). [5]
------------------------------------------------------------------------------------

References

1 Genome-wide association study of coronary artery calcified atherosclerotic plaque in African Americans with type 2 diabetes.BMC Genet. 2017 Dec 8;18(1):105. doi: 10.1186/s12863-017-0572-9.
2 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
3 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
4 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5 Levonorgestrel enhances spermatogenesis suppression by testosterone with greater alteration in testicular gene expression in men. Biol Reprod. 2009 Mar;80(3):484-92.