| DOT Name |
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform (PPP2R2D)
|
| Synonyms |
PP2A subunit B isoform B55-delta; PP2A subunit B isoform PR55-delta; PP2A subunit B isoform R2-delta; PP2A subunit B isoform delta |
| Gene Name |
PPP2R2D
|
| Related Disease |
- Acute otitis media ( )
- Hepatocellular carcinoma ( )
- Neoplasm ( )
- Otitis media ( )
|
| UniProt ID |
|
| 3D Structure |
|
| Sequence |
MAGAGGGGCPAGGNDFQWCFSQVKGAIDEDVAEADIISTVEFNYSGDLLATGDKGGRVVI
FQREQENKSRPHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVFVYSSSKGTIRLCDMRSSALCDRHSKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRDTRRDVTLEASRESSKPRASLKPRKVCTGGKRRKDEISVDSLD
FNKKILHTAWHPVDNVIAVAATNNLYIFQDKIN
|
| Function |
B regulatory subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit. The activity of PP2A complexes containing PPP2R2D (PR55-delta) fluctuate during the cell cycle: the activity is high in interphase and low in mitosis. During mitosis, activity of PP2A is inhibited via interaction with phosphorylated ENSA and ARPP19 inhibitors. Within the PP2A complexes, the B regulatory subunits modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.
|
| KEGG Pathway |
- mR. surveillance pathway (hsa03015 )
- Sphingolipid sig.ling pathway (hsa04071 )
- PI3K-Akt sig.ling pathway (hsa04151 )
- AMPK sig.ling pathway (hsa04152 )
- Adrenergic sig.ling in cardiomyocytes (hsa04261 )
- Hippo sig.ling pathway (hsa04390 )
- Tight junction (hsa04530 )
- T cell receptor sig.ling pathway (hsa04660 )
- Dopaminergic sy.pse (hsa04728 )
- Chagas disease (hsa05142 )
- Hepatitis C (hsa05160 )
- Human papillomavirus infection (hsa05165 )
|
| Reactome Pathway |
- MASTL Facilitates Mitotic Progression (R-HSA-2465910 )
|
|
|
|
|
|
|
