Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDYKD95)

DOT Name Caprin-2 (CAPRIN2)
Synonyms C1q domain-containing protein 1; Cytoplasmic activation/proliferation-associated protein 2; Gastric cancer multidrug resistance-associated protein; Protein EEG-1; RNA granule protein 140
Gene Name CAPRIN2
Related Disease
Lung cancer ( )
Lung carcinoma ( )
Neoplasm ( )
UniProt ID
CAPR2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4OUL; 4OUM; 5J97
Pfam ID
PF00386 ; PF12287 ; PF18293
Sequence
MEVQVSQASLGFELTSVEKSLREWSRLSREVIAWLCPSSPNFILNFPPPPSASSVSMVQL
FSSPFGYQSPSGHSEEEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASPSQAYET
YIENGLICLKHKIRNIEKKKLKLEDYKDRLKSGEHLNPDQLEAVEKYEEVLHNLEFAKEL
QKTFSGLSLDLLKAQKKAQRREHMLKLEAEKKKLRTILQVQYVLQNLTQEHVQKDFKGGL
NGAVYLPSKELDYLIKFSKLTCPERNESLSVEDQMEQSSLYFWDLLEGSEKAVVGTTYKH
LKDLLSKLLNSGYFESIPVPKNAKEKEVPLEEEMLIQSEKKTQLSKTESVKESESLMEFA
QPEIQPQEFLNRRYMTEVDYSNKQGEEQPWEADYARKPNLPKRWDMLTEPDGQEKKQESF
KSWEASGKHQEVSKPAVSLEQRKQDTSKLRSTLPEEQKKQEISKSKPSPSQWKQDTPKSK
AGYVQEEQKKQETPKLWPVQLQKEQDPKKQTPKSWTPSMQSEQNTTKSWTTPMCEEQDSK
QPETPKSWENNVESQKHSLTSQSQISPKSWGVATASLIPNDQLLPRKLNTEPKDVPKPVH
QPVGSSSTLPKDPVLRKEKLQDLMTQIQGTCNFMQESVLDFDKPSSAIPTSQPPSATPGS
PVASKEQNLSSQSDFLQEPLQATSSPVTCSSNACLVTTDQASSGSETEFMTSETPEAAIP
PGKQPSSLASPNPPMAKGSEQGFQSPPASSSSVTINTAPFQAMQTVFNVNAPLPPRKEQE
IKESPYSPGYNQSFTTASTQTPPQCQLPSIHVEQTVHSQETAANYHPDGTIQVSNGSLAF
YPAQTNVFPRPTQPFVNSRGSVRGCTRGGRLITNSYRSPGGYKGFDTYRGLPSISNGNYS
QLQFQAREYSGAPYSQRDNFQQCYKRGGTSGGPRANSRAGWSDSSQVSSPERDNETFNSG
DSGQGDSRSMTPVDVPVTNPAATILPVHVYPLPQQMRVAFSAARTSNLAPGTLDQPIVFD
LLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEVLVSAYANDGA
PDHETASNHAILQLFQGDQIWLRLHRGAIYGSSWKYSTFSGYLLYQD
Function
Promotes phosphorylation of the Wnt coreceptor LRP6, leading to increased activity of the canonical Wnt signaling pathway. Facilitates constitutive LRP6 phosphorylation by CDK14/CCNY during G2/M stage of the cell cycle, which may potentiate cells for Wnt signaling. May regulate the transport and translation of mRNAs, modulating for instance the expression of proteins involved in synaptic plasticity in neurons. Involved in regulation of growth as erythroblasts shift from a highly proliferative state towards their terminal phase of differentiation. May be involved in apoptosis.
Tissue Specificity Detected in all tissues tested with highest levels of expression in brain and spleen.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lung cancer DISCM4YA Strong Genetic Variation [1]
Lung carcinoma DISTR26C Strong Genetic Variation [1]
Neoplasm DISZKGEW Strong Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Caprin-2 (CAPRIN2). [3]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Caprin-2 (CAPRIN2). [4]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Caprin-2 (CAPRIN2). [5]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Caprin-2 (CAPRIN2). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Caprin-2 (CAPRIN2). [7]
Quercetin DM3NC4M Approved Quercetin increases the expression of Caprin-2 (CAPRIN2). [8]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Caprin-2 (CAPRIN2). [9]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of Caprin-2 (CAPRIN2). [10]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Caprin-2 (CAPRIN2). [11]
ORG2058 DMH1M6N Investigative ORG2058 increases the expression of Caprin-2 (CAPRIN2). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Methacrylic acid/butyl acrylate onto feruloylated bagasse xylan: Graft copolymerization and biological activity.Mater Sci Eng C Mater Biol Appl. 2019 May;98:594-601. doi: 10.1016/j.msec.2018.12.103. Epub 2018 Dec 30.
2 Exome sequencing of hepatoblastoma reveals novel mutations and cancer genes in the Wnt pathway and ubiquitin ligase complex.Hepatology. 2014 Nov;60(5):1686-96. doi: 10.1002/hep.27243. Epub 2014 Sep 19.
3 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
4 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
5 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
6 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
10 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
11 BET bromodomain inhibition targets both c-Myc and IL7R in high-risk acute lymphoblastic leukemia. Blood. 2012 Oct 4;120(14):2843-52.
12 The antiproliferative effects of progestins in T47D breast cancer cells are tempered by progestin induction of the ETS transcription factor Elf5. Mol Endocrinol. 2010 Jul;24(7):1380-92. doi: 10.1210/me.2009-0516. Epub 2010 Jun 2.