| DOT Name |
Eukaryotic translation initiation factor 3 subunit L (EIF3L)
|
| Synonyms |
eIF3l; Eukaryotic translation initiation factor 3 subunit 6-interacting protein; Eukaryotic translation initiation factor 3 subunit E-interacting protein |
| Gene Name |
EIF3L
|
| Related Disease |
- Prostate cancer ( )
- Prostate carcinoma ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
3J8B ; 3J8C ; 6FEC ; 6YBD ; 6ZMW ; 6ZON ; 6ZP4 ; 6ZVJ ; 7A09 ; 7QP6 ; 7QP7 ; 8PPL |
| Pfam ID |
|
| Sequence |
MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFH
KTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAP
QVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPN
QWLWDIIDEFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNI
NRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELN
KKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMI
NKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKF
LSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLD
LTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYG
DFFIRQIHKFEELNRTLKKMGQRP
|
| Function |
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression ; (Microbial infection) In case of FCV infection, plays a role in the ribosomal termination-reinitiation event leading to the translation of VP2.
|
| Reactome Pathway |
- Translation initiation complex formation (R-HSA-72649 )
- Formation of a pool of free 40S subunits (R-HSA-72689 )
- Formation of the ternary complex, and subsequently, the 43S complex (R-HSA-72695 )
- Ribosomal scanning and start codon recognition (R-HSA-72702 )
- GTP hydrolysis and joining of the 60S ribosomal subunit (R-HSA-72706 )
- L13a-mediated translational silencing of Ceruloplasmin expression (R-HSA-156827 )
|
|
|
|
|
|
|
