Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEZUT8V)

• DOT Name: Ecto-ADP-ribosyltransferase 5 (ART5)
• Synonyms: EC 2.4.2.31; ADP-ribosyltransferase C2 and C3 toxin-like 5; ARTC5; Mono(ADP-ribosyl)transferase 5; NAD(P)(+)--arginine ADP-ribosyltransferase 5
• Gene Name: ART5
• Related Disease: Vibrio cholerae infection
• UniProt ID: NAR5_HUMAN
• EC Number: 2.4.2.31
• Pfam ID: PF01129
• Sequence:
  MALAALMIALGSLGLHTWQAQAVPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAH
  HALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGS
  RELYMRHFPFKALHFYLIRALQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQ
  FASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSVFPKEREVLIPPHEVFLVTRFSQDGA
  QSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDLHMTKRHLQQP

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Vibrio cholerae infection	DISW7E3U	Strong	Genetic Variation	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ecto-ADP-ribosyltransferase 5 (ART5).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ecto-ADP-ribosyltransferase 5 (ART5).	[7]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Ecto-ADP-ribosyltransferase 5 (ART5).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Ecto-ADP-ribosyltransferase 5 (ART5).	[4]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Ecto-ADP-ribosyltransferase 5 (ART5).	[5]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Ecto-ADP-ribosyltransferase 5 (ART5).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Ecto-ADP-ribosyltransferase 5 (ART5).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ecto-ADP-ribosyltransferase 5 (ART5).	[9]

References

• [1] Emissive Synthetic Cofactors: An Isomorphic, Isofunctional, and Responsive NAD(+) Analogue.J Am Chem Soc. 2017 Nov 8;139(44):15556-15559. doi: 10.1021/jacs.7b05852. Epub 2017 Oct 27.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [5] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [6] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.