Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF1ETS6)

DOT Name	Coiled-coil domain-containing protein 83 (CCDC83)
Gene Name	CCDC83
Related Disease	Advanced cancer ( ) Alzheimer disease ( ) Colon cancer ( ) Colon carcinoma ( ) Neoplasm ( ) Testicular cancer ( )
UniProt ID	CCD83_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MENSGKANKKDTHDGPPKEIKLPTSEALLDYQCQIKEDAVEQFMFQIKTLRKKNQKYHER NSRLKEEQIWHIRHLLKELSEEKAEGLPVVTREDVEEAMKEKWKFERDQEKNLRDMRMQI SNAEKLFLEKLSEKEYWEEYKNVGSERHAKLITSLQNDINTVKENAEKMSEHYKITLEDT RKKIIKETLLQLDQKKEWATQNAVKLIDKGSYLEIWENDWLKKEVAIHRKEVEELKNAIH ELEAENLVLIDQLSNCRLVDLKIPRRLYLTQAAGLEVPPEEMSLELPETHIEEKSELQPT EVESRDLMSSSDESTILHLSHENSIEDLQYVKIDKEENSGTEFGDTDMKYLLYEDEKDFK DYVNLGPLGVKLMSVESKKMPIHFQEKEIPVKLYKDVRSPESHITYKMMKSFL

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[2]
Colon cancer	DISVC52G	Strong	Altered Expression	[1]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Testicular cancer	DIS6HNYO	Strong	Biomarker	[1]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Coiled-coil domain-containing protein 83 (CCDC83).	[3]
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Coiled-coil domain-containing protein 83 (CCDC83).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Coiled-coil domain-containing protein 83 (CCDC83).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Coiled-coil domain-containing protein 83 (CCDC83).	[7]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Coiled-coil domain-containing protein 83 (CCDC83).	[4]
------------------------------------------------------------------------------------

References

1	KP-CoT-23 (CCDC83) is a novel immunogenic cancer/testis antigen in colon cancer.Int J Oncol. 2012 Nov;41(5):1820-6. doi: 10.3892/ijo.2012.1601. Epub 2012 Aug 22.
2	Genome-wide association study of Alzheimer's disease.Transl Psychiatry. 2012 May 15;2(5):e117. doi: 10.1038/tp.2012.45.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
5	Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.