Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF4SWJ8)

• DOT Name: Protein kish-B (TMEM167B)
• Synonyms: Transmembrane protein 167B
• Gene Name: TMEM167B
• UniProt ID: KISHB_HUMAN
• Pfam ID: PF06842
• Sequence:
  MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVA
  IACVVMAFYVLFIK
• Function: Involved in the early part of the secretory pathway.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein kish-B (TMEM167B).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein kish-B (TMEM167B).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein kish-B (TMEM167B).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein kish-B (TMEM167B).	[4]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein kish-B (TMEM167B).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein kish-B (TMEM167B).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure affects the expression of Protein kish-B (TMEM167B).	[8]
CH-223191	DMMJZYC	Investigative	CH-223191 increases the expression of Protein kish-B (TMEM167B).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Protein kish-B (TMEM167B).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [9] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.