Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFAU0YL)

• DOT Name: Microfibril-associated glycoprotein 3 (MFAP3)
• Gene Name: MFAP3
• Related Disease: Colorectal carcinoma
• UniProt ID: MFAP3_HUMAN
• Pfam ID: PF00047
• Sequence:
  MKLHCCLFTLVASIIVPAAFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDV
  IIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRG
  LYTCFVTSPIRASYSVTLRVIFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKT
  EKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVP
  LPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDS
  DDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGAYENC
  QL
• Function: Component of the elastin-associated microfibrils.
• Reactome Pathway: Molecules associated with elastic fibres (R-HSA-2129379)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Microfibril-associated glycoprotein 3 (MFAP3).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Microfibril-associated glycoprotein 3 (MFAP3).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Microfibril-associated glycoprotein 3 (MFAP3).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Microfibril-associated glycoprotein 3 (MFAP3).	[5]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Microfibril-associated glycoprotein 3 (MFAP3).	[6]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Microfibril-associated glycoprotein 3 (MFAP3).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Microfibril-associated glycoprotein 3 (MFAP3).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Microfibril-associated glycoprotein 3 (MFAP3).	[8]

References

• [1] MFAP3L activation promotes colorectal cancer cell invasion and metastasis.Biochim Biophys Acta. 2014 Sep;1842(9):1423-32. doi: 10.1016/j.bbadis.2014.04.006. Epub 2014 Apr 13.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.