Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFC3010)

• DOT Name: Vasodilator-stimulated phosphoprotein
• Synonyms: VASP
• Gene Name: VASP
• UniProt ID: VASP_HUMAN
• PDB ID: 1EGX; 1USD; 1USE; 2PAV; 2PBD; 3CHW
• Pfam ID: PF08776 ; PF00568
• Sequence:
  MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQV
  VINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPP
  PPALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPP
  GPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSK
  QEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVP
  AQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQ
  KVKEEIIEAFVQELRKRGSP
• Function: Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance, lamellipodial and filopodial dynamics, platelet activation and cell migration. VASP promotes actin filament elongation. It protects the barbed end of growing actin filaments against capping and increases the rate of actin polymerization in the presence of capping protein. VASP stimulates actin filament elongation by promoting the transfer of profilin-bound actin monomers onto the barbed end of growing actin filaments. Plays a role in actin-based mobility of Listeria monocytogenes in host cells. Regulates actin dynamics in platelets and plays an important role in regulating platelet aggregation.
• Tissue Specificity: Highly expressed in platelets.
• KEGG Pathway:
  Rap1 sig.ling pathway (hsa04015)
  cGMP-PKG sig.ling pathway (hsa04022)
  Focal adhesion (hsa04510)
  Tight junction (hsa04530)
  Platelet activation (hsa04611)
  Fc gamma R-mediated phagocytosis (hsa04666)
  Leukocyte transendothelial migration (hsa04670)
• Reactome Pathway:
  Signaling by ROBO receptors (R-HSA-376176)
  Cell-extracellular matrix interactions (R-HSA-446353)
  Generation of second messenger molecules (R-HSA-202433)

Molecular Interaction Atlas (MIA) of This DOT

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Vasodilator-stimulated phosphoprotein.	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Vasodilator-stimulated phosphoprotein.	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Vasodilator-stimulated phosphoprotein.	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Vasodilator-stimulated phosphoprotein.	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Vasodilator-stimulated phosphoprotein.	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Vasodilator-stimulated phosphoprotein.	[6]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Vasodilator-stimulated phosphoprotein.	[7]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Vasodilator-stimulated phosphoprotein.	[8]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Vasodilator-stimulated phosphoprotein.	[9]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Vasodilator-stimulated phosphoprotein.	[10]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Vasodilator-stimulated phosphoprotein.	[8]
Tacrolimus	DMZ7XNQ	Approved	Tacrolimus decreases the expression of Vasodilator-stimulated phosphoprotein.	[11]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Vasodilator-stimulated phosphoprotein.	[14]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Vasodilator-stimulated phosphoprotein.	[3]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Vasodilator-stimulated phosphoprotein.	[15]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Vasodilator-stimulated phosphoprotein.	[17]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Vasodilator-stimulated phosphoprotein.	[19]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Vasodilator-stimulated phosphoprotein.	[20]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Vasodilator-stimulated phosphoprotein.	[22]

8 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Alprostadil	DMWH7NQ	Approved	Alprostadil increases the phosphorylation of Vasodilator-stimulated phosphoprotein.	[12]
Glyceryl trinitrate	DMF72W3	Phase 4	Glyceryl trinitrate increases the phosphorylation of Vasodilator-stimulated phosphoprotein.	[13]
EXISULIND	DMBY56U	Phase 3	EXISULIND increases the phosphorylation of Vasodilator-stimulated phosphoprotein.	[16]
CP-461	DMEYMTX	Phase 2	CP-461 increases the phosphorylation of Vasodilator-stimulated phosphoprotein.	[18]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Vasodilator-stimulated phosphoprotein.	[21]
Forskolin	DM6ITNG	Investigative	Forskolin increases the phosphorylation of Vasodilator-stimulated phosphoprotein.	[23]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR increases the phosphorylation of Vasodilator-stimulated phosphoprotein.	[24]
adenosine diphosphate	DMFUHKP	Investigative	adenosine diphosphate increases the phosphorylation of Vasodilator-stimulated phosphoprotein.	[25]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Progestins regulate genes that can elicit both proliferative and antiproliferative effects in breast cancer cells. Oncol Rep. 2008 Jun;19(6):1627-34.
• [8] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [9] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [10] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [11] Calcineurin is an important factor involved in glucose uptake in human adipocytes. Mol Cell Biochem. 2018 Aug;445(1-2):157-168. doi: 10.1007/s11010-017-3261-0. Epub 2018 Jan 27.
• [12] Arsenic trioxide-mediated antiplatelet activity: pivotal role of the phospholipase C gamma 2-protein kinase C-p38 MAPK cascade. Transl Res. 2010 Feb;155(2):97-108. doi: 10.1016/j.trsl.2009.08.005. Epub 2009 Sep 15.
• [13] Inhibitory mechanisms of resveratrol in platelet activation: pivotal roles of p38 MAPK and NO/cyclic GMP. Br J Haematol. 2007 Nov;139(3):475-85. doi: 10.1111/j.1365-2141.2007.06788.x. Epub 2007 Sep 14.
• [14] Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
• [15] Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
• [16] Activation of protein kinase G up-regulates expression of 15-lipoxygenase-1 in human colon cancer cells. Cancer Res. 2005 Sep 15;65(18):8442-7.
• [17] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [18] Synergistic effects of acyclic retinoid and OSI-461 on growth inhibition and gene expression in human hepatoma cells. Clin Cancer Res. 2004 Oct 1;10(19):6710-21. doi: 10.1158/1078-0432.CCR-04-0659.
• [19] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [20] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [21] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [22] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [23] AKT Ser/Thr kinase increases V-ATPase-dependent lysosomal acidification in response to amino acid starvation in mammalian cells. J Biol Chem. 2020 Jul 10;295(28):9433-9444. doi: 10.1074/jbc.RA120.013223. Epub 2020 May 14.
• [24] Hyperphosphorylation of microfilament-associated proteins is involved in microcystin-LR-induced toxicity in HL7702 cells. Environ Toxicol. 2015 Jul 8;30(8):981-8. doi: 10.1002/tox.21974. Epub 2014 Feb 21.
• [25] Another "string to the bow" of PJ34, a potent poly(ADP-Ribose)polymerase inhibitor: an antiplatelet effect through P2Y12 antagonism?. PLoS One. 2014 Oct 20;9(10):e110776. doi: 10.1371/journal.pone.0110776. eCollection 2014.