Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFH7ZM3)

• DOT Name: Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1)
• Synonyms: Ankyrin repeat domain-containing protein 5
• Gene Name: ANKEF1
• Related Disease:
  Advanced cancer
  Asthma
• UniProt ID: ANKE1_HUMAN
• Pfam ID: PF12796
• Sequence:
  MALADKRLENLQIYKVLQCVRNKDKKQIEKLTKLGYPELINYTEPINGLSALHLASVSND
  IDMVSFLLDLGAHPDVQDRMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFY
  CILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRACEDAHDVKDVCLTFLEKGANPNAI
  NSSTGRTALMEASREGVVEIVRGILERGGEVNAFDNDRHHAAHFAAKGGFFDILKLLFAY
  NGDVGLISINGNTPLHYAAMGGFADCCKYIAQRGCDLKWKNLDHKTPRAVAKEGGFKAAS
  KEIRRAERIANKLARPGAKNPNPLWALRLHDWSVEREAFLREAFAVLDRGDGSISKNDFV
  MVLEERQDYASSEQLAAIAHLHEKTRGGGVNINEFFKGTRYLNKSFVLGSYGPKKKEKGM
  GKKGKKGKFVLPLPICVIPEYAFPRRQDGGPPYYMIETYKNVTDSSRFNRDHPPEHPIQD
  DSVWYIDDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDV
  VKFLLEKGANVNATDNFLWTPLHFACHAGQQDIVELLVESGALIDAASINNSTPLNRAIE
  SCRLDTVKYLLDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLK
  GKTPPILKTEGPEIKKEEELLSSIYGVPTTSEGKKVQKGNVVHLNSLITSGYTKKVDITF
  IPRRIWSPEATTAELIRKRELRRERFTHEVDFDDFMMPFQKNITEKARALEAALKT

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Limited	Genetic Variation	[1]
Asthma	DISW9QNS	Limited	Biomarker	[2]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[9]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[10]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[11]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[12]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[13]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Ankyrin repeat and EF-hand domain-containing protein 1 (ANKEF1).	[14]

References

• [1] Maternal intake of high n-6 polyunsaturated fatty acid diet during pregnancy causes transgenerational increase in mammary cancer risk in mice.Breast Cancer Res. 2017 Jul 3;19(1):77. doi: 10.1186/s13058-017-0866-x.
• [2] Sex-specific linkage to total serum immunoglobulin E in families of children with asthma in Costa Rica.Hum Mol Genet. 2007 Feb 1;16(3):243-53. doi: 10.1093/hmg/ddl447. Epub 2006 Dec 1.
• [3] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [4] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [8] Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [11] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [12] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [13] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [14] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.