Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFXRU35)

• DOT Name: Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11)
• Synonyms: Solute carrier family 38 member 11
• Gene Name: SLC38A11
• UniProt ID: S38AB_HUMAN
• Pfam ID: PF01490
• Sequence:
  MKQAGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQF
  LYPFIAMISYNIIAGDTLSKVFQRIPGVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAK
  LGKVSLISTGLTTLILGIVMARAISLGPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHN
  SFLVYSSLEEPTVAKWSRLIHMSIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDL
  VTFGRFCYGVTVILTYPMECFVTREVIANVFFGGNLSSVFHIVVTVMVITVATLVSLLID
  CLGIVLELNGVLCATPLIFIIPSACYLKLSEEPRTHSDKIMSCVMLPIGAVVMVFGFVMA
  ITNTQDCTHGQEMFYCFPDNFSLTNTSESHVQQTTQLSTLNISIFQ
• Function: Putative sodium-dependent amino acid/proton antiporter.

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11).	[1]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11).	[5]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11).	[6]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11).	[7]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Putative sodium-coupled neutral amino acid transporter 11 (SLC38A11).	[8]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [7] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.