Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG4EK2P)

• DOT Name: Cilia- and flagella-associated protein 68 (CFAP68)
• Gene Name: CFAP68
• UniProt ID: CFA68_HUMAN
• PDB ID: 7UNG; 8J07
• Pfam ID: PF06608
• Sequence:
  MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTN
  ENTYSNRTLMGNWNQERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREP
  HWFPGHQPELDPPRYKCTEKSTYMNSYSKP
• Function: Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cilia- and flagella-associated protein 68 (CFAP68).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Cilia- and flagella-associated protein 68 (CFAP68).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cilia- and flagella-associated protein 68 (CFAP68).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cilia- and flagella-associated protein 68 (CFAP68).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cilia- and flagella-associated protein 68 (CFAP68).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cilia- and flagella-associated protein 68 (CFAP68).	[6]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Cilia- and flagella-associated protein 68 (CFAP68).	[7]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Cilia- and flagella-associated protein 68 (CFAP68).	[8]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Cilia- and flagella-associated protein 68 (CFAP68).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Cilia- and flagella-associated protein 68 (CFAP68).	[10]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [8] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [9] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.