Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG5B19W)

• DOT Name: MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L)
• Synonyms: Mitogen-activated protein kinase 1-interacting protein 1-like
• Gene Name: MAPK1IP1L
• Related Disease:
  Lung cancer
  Lung carcinoma
• UniProt ID: MISSL_HUMAN
• Pfam ID: PF15822
• Sequence:
  MSDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPS
  TVPFGPAPTGMYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPN
  MPFPELPRPYGAPTDPAAAGPLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPP
  QAPGAAPPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG
  PHSYH

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Strong	Biomarker	[1]
Lung carcinoma	DISTR26C	Strong	Biomarker	[1]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[7]
Marinol	DM70IK5	Approved	Marinol increases the expression of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[8]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[9]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[12]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L).	[11]

References

• [1] Urine Proteome Profiling Predicts Lung Cancer from Control Cases and Other Tumors.EBioMedicine. 2018 Apr;30:120-128. doi: 10.1016/j.ebiom.2018.03.009. Epub 2018 Mar 17.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [6] Systematic transcriptome-based comparison of cellular adaptive stress response activation networks in hepatic stem cell-derived progeny and primary human hepatocytes. Toxicol In Vitro. 2021 Jun;73:105107. doi: 10.1016/j.tiv.2021.105107. Epub 2021 Feb 3.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [11] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [12] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.