Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG93YV0)

DOT Name	Alpha-amylase 2B (AMY2B)
Synonyms	EC 3.2.1.1; 1,4-alpha-D-glucan glucanohydrolase 2B; Carcinoid alpha-amylase
Gene Name	AMY2B
Related Disease	Carcinoid tumor ( ) Lung cancer ( ) Non-syndromic ichthyosis ( ) Obesity ( )
UniProt ID	AMY2B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.2.1.1
Pfam ID	PF00128 ; PF02806
Sequence	MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGN AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGL LDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAG SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP RQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
KEGG Pathway	Starch and sucrose metabolism (hsa00500 ) Metabolic pathways (hsa01100 ) Salivary secretion (hsa04970 ) Pancreatic secretion (hsa04972 ) Carbohydrate digestion and absorption (hsa04973 )
Reactome Pathway	Digestion of dietary carbohydrate (R-HSA-189085 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Carcinoid tumor	DISMNRDC	Strong	Biomarker	[1]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[2]
Non-syndromic ichthyosis	DISZ9QBQ	Strong	Genetic Variation	[3]
Obesity	DIS47Y1K	Strong	Genetic Variation	[4]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Alpha-amylase 2B (AMY2B).	[5]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Alpha-amylase 2B (AMY2B).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Alpha-amylase 2B (AMY2B).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Alpha-amylase 2B (AMY2B).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Alpha-amylase 2B (AMY2B).	[10]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Alpha-amylase 2B (AMY2B).	[9]
------------------------------------------------------------------------------------

References

1	A novel type of human alpha-amylase produced in lung carcinoid tumor.Gene. 1989 Mar 15;76(1):11-8. doi: 10.1016/0378-1119(89)90003-6.
2	Amylase mRNA transcripts in normal tissues and neoplasms: the implication of different expressions of amylase isogenes.J Cancer Res Clin Oncol. 1994;120(4):213-20. doi: 10.1007/BF01372559.
3	Hepoxilin A3 (HXA3) synthase deficiency is causative of a novel ichthyosis form.FEBS Lett. 2008 Jan 23;582(2):279-85. doi: 10.1016/j.febslet.2007.12.017. Epub 2007 Dec 18.
4	Obesity, starch digestion and amylase: association between copy number variants at human salivary (AMY1) and pancreatic (AMY2) amylase genes.Hum Mol Genet. 2015 Jun 15;24(12):3472-80. doi: 10.1093/hmg/ddv098. Epub 2015 Mar 18.
5	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
6	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
7	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
8	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
10	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.