Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGMAHAT)

DOT Name Alkylglycerol monooxygenase (AGMO)
Synonyms EC 1.14.16.5; Transmembrane protein 195
Gene Name AGMO
Related Disease
Epilepsy ( )
Intellectual disability ( )
Isolated congenital microcephaly ( )
Visceral leishmaniasis ( )
Pulmonary tuberculosis ( )
Autism spectrum disorder ( )
Neurodevelopmental disorder ( )
Prostate carcinoma ( )
UniProt ID
ALKMO_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
1.14.16.5
Pfam ID
PF04116
Sequence
MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISLMLLELVVSWI
LKGKPPGRLDDALTSISAGVLSRLPSLFFRSIELTSYIYIWENYRLFNLPWDSPWTWYSA
FLGVDFGYYWFHRMAHEVNIMWAGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALF
IPPSVYAVHLQFNLLYQFWIHTEVINNLGPLELILNTPSHHRVHHGRNRYCIDKNYAGVL
IIWDKIFGTFEAENEKVVYGLTHPINTFEPIKVQFHHLFSIWTTFWATPGFFNKFSVIFK
GPGWGPGKPRLGLSEEIPEVTGKEVPFSSSSSQLLKIYTVVQFALMLAFYEETFADTAAL
SQVTLLLRVCFIILTLTSIGFLLDQRPKAAIMETLRCLMFLMLYRFGHLKPLVPSLSSAF
EIVFSICIAFWGVRSMKQLTSHPWK
Function Glyceryl-ether monooxygenase that cleaves the O-alkyl bond of ether lipids. Ether lipids are essential components of brain membranes.
Reactome Pathway
Triglyceride biosynthesis (R-HSA-75109 )

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Epilepsy DISBB28L Strong Biomarker [1]
Intellectual disability DISMBNXP Strong Biomarker [1]
Isolated congenital microcephaly DISUXHZ6 Strong Genetic Variation [1]
Visceral leishmaniasis DISTKEYK Strong Biomarker [2]
Pulmonary tuberculosis DIS6FLUM moderate Genetic Variation [3]
Autism spectrum disorder DISXK8NV Limited Autosomal dominant [4]
Neurodevelopmental disorder DIS372XH Limited Genetic Variation [1]
Prostate carcinoma DISMJPLE Limited Genetic Variation [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Alkylglycerol monooxygenase (AGMO). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Alkylglycerol monooxygenase (AGMO). [12]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Alkylglycerol monooxygenase (AGMO). [7]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Alkylglycerol monooxygenase (AGMO). [8]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Alkylglycerol monooxygenase (AGMO). [9]
Marinol DM70IK5 Approved Marinol decreases the expression of Alkylglycerol monooxygenase (AGMO). [10]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Alkylglycerol monooxygenase (AGMO). [11]
------------------------------------------------------------------------------------

References

1 Biallelic variants in AGMO with diminished enzyme activity are associated with a neurodevelopmental disorder.Hum Genet. 2019 Dec;138(11-12):1259-1266. doi: 10.1007/s00439-019-02065-x. Epub 2019 Sep 25.
2 Exome Sequencing Identifies Two Variants of the Alkylglycerol Monooxygenase Gene as a Cause of Relapses in Visceral Leishmaniasis in Children, in Sudan.J Infect Dis. 2017 Jul 1;216(1):22-28. doi: 10.1093/infdis/jix277.
3 A genome-wide association study of pulmonary tuberculosis in Morocco.Hum Genet. 2016 Mar;135(3):299-307. doi: 10.1007/s00439-016-1633-2. Epub 2016 Jan 14.
4 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
5 Radiogenomics Consortium Genome-Wide Association Study Meta-Analysis of Late Toxicity After Prostate Cancer Radiotherapy.J Natl Cancer Inst. 2020 Feb 1;112(2):179-190. doi: 10.1093/jnci/djz075.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
8 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
9 Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
10 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
11 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.