Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGQ8GWM)

• DOT Name: SEC14-like protein 3 (SEC14L3)
• Synonyms: Tocopherol-associated protein 2
• Gene Name: SEC14L3
• Related Disease:
  Allergic asthma
  Asthma
  Burkitt lymphoma
  Familial multiple trichoepithelioma
  Lung cancer
  Lung carcinoma
  Tuberculosis
  Type-1 diabetes
• UniProt ID: S14L3_HUMAN
• PDB ID: 4UYB
• Pfam ID: PF00650
• Sequence:
  MSGRVGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEALLRKYM
  EFRKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDL
  LKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEE
  NYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELPAQ
  FGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFPG
  CVLRWQFSSDGADIGFGVFLKTKMGERQRAGEMTDVLPSQRYNAHMVPEDGNLTCSEAGV
  YVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDKELTPV
• Function: Probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Allergic asthma	DISHF0H3	Strong	Biomarker	[1]
Asthma	DISW9QNS	Strong	Altered Expression	[1]
Burkitt lymphoma	DIS9D5XU	Strong	Biomarker	[2]
Familial multiple trichoepithelioma	DISKZAUY	Strong	Altered Expression	[3]
Lung cancer	DISCM4YA	Strong	Altered Expression	[4]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[4]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[5]
Type-1 diabetes	DIS7HLUB	moderate	Altered Expression	[6]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Daunorubicin	DMQUSBT	Approved	SEC14-like protein 3 (SEC14L3) increases the Bone marrow failure ADR of Daunorubicin.	[9]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of SEC14-like protein 3 (SEC14L3).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of SEC14-like protein 3 (SEC14L3).	[8]

References

• [1] Pulmonary microRNA profiles identify involvement of Creb1 and Sec14l3 in bronchial epithelial changes in allergic asthma.Sci Rep. 2017 Apr 6;7:46026. doi: 10.1038/srep46026.
• [2] RelB nuclear translocation mediated by C-terminal activator regions of Epstein-Barr virus-encoded latent membrane protein 1 and its effect on antigen-presenting function in B cells.J Virol. 2002 Feb;76(4):1914-21. doi: 10.1128/jvi.76.4.1914-1921.2002.
• [3] Trastuzumab mediated T-cell response against HER-2/neu overexpressing esophageal adenocarcinoma depends on intact antigen processing machinery.PLoS One. 2010 Aug 26;5(8):e12424. doi: 10.1371/journal.pone.0012424.
• [4] Molecular characterization of defective antigen processing in human prostate cancer.J Natl Cancer Inst. 1995 Feb 15;87(4):280-5. doi: 10.1093/jnci/87.4.280.
• [5] Molecular modelling and simulation studies of the Mycobacterium tuberculosis multidrug efflux pump protein Rv1258c.PLoS One. 2018 Nov 26;13(11):e0207605. doi: 10.1371/journal.pone.0207605. eCollection 2018.
• [6] Tap-1 and Tap-2 gene therapy selectively restores conformationally dependent HLA Class I expression in type I diabetic cells.Hum Gene Ther. 1995 Aug;6(8):1005-17. doi: 10.1089/hum.1995.6.8-1005.
• [7] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Genetic variants contributing to daunorubicin-induced cytotoxicity. Cancer Res. 2008 May 1;68(9):3161-8. doi: 10.1158/0008-5472.CAN-07-6381.