Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHCX9RH)

DOT Name Testis-specific Y-encoded-like protein 4 (TSPYL4)
Synonyms TSPY-like protein 4
Gene Name TSPYL4
Related Disease
Dravet syndrome ( )
Chronic obstructive pulmonary disease ( )
Melanoma ( )
UniProt ID
TSYL4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00956
Sequence
MSGLDGGNKLPLAQTGGLAAPDHASGDPDRDQCQGLREETEATQVMANTGGGSLETVAEG
GASQDPVDCGPALRVPVAGSRGGAATKAGQEDAPPSTKGLEAASAAEAADSSQKNGCQLG
EPRGPAGQKALEACGAGGLGSQMIPGKKAKEVTTKKRAISAAVEKEGEAGAAMEEKKVVQ
KEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLERKFGRMRRLHM
QRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMLRYMINLEVEELKHPRAGCKFKFIF
QGNPYFRNEGLVKEYERRSSGRVVSLSTPIRWHRGQDPQAHIHRNREGNTIPSFFNWFSD
HSLLEFDRIAEIIKGELWPNPLQYYLMGEGPRRGIRGPPRQPVESARSFRFQSG

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Dravet syndrome DISJF7LY Strong Genetic Variation [1]
Chronic obstructive pulmonary disease DISQCIRF moderate Genetic Variation [2]
Melanoma DIS1RRCY Limited Biomarker [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Testis-specific Y-encoded-like protein 4 (TSPYL4). [4]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Testis-specific Y-encoded-like protein 4 (TSPYL4). [5]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Testis-specific Y-encoded-like protein 4 (TSPYL4). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Testis-specific Y-encoded-like protein 4 (TSPYL4). [7]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Testis-specific Y-encoded-like protein 4 (TSPYL4). [8]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Testis-specific Y-encoded-like protein 4 (TSPYL4). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Testis-specific Y-encoded-like protein 4 (TSPYL4). [10]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of Testis-specific Y-encoded-like protein 4 (TSPYL4). [6]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Testis-specific Y-encoded-like protein 4 (TSPYL4). [12]
Nickel chloride DMI12Y8 Investigative Nickel chloride decreases the expression of Testis-specific Y-encoded-like protein 4 (TSPYL4). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Testis-specific Y-encoded-like protein 4 (TSPYL4). [11]
------------------------------------------------------------------------------------

References

1 Identification of SCN1A and PCDH19 mutations in Chinese children with Dravet syndrome.PLoS One. 2012;7(7):e41802. doi: 10.1371/journal.pone.0041802. Epub 2012 Jul 25.
2 Single-nucleotide polymorphisms in the TSPYL-4 and NT5DC1 genes are associated with susceptibility to chronic obstructive pulmonary disease.Mol Med Rep. 2012 Sep;6(3):631-8. doi: 10.3892/mmr.2012.964. Epub 2012 Jun 25.
3 Aggressiveness of human melanoma xenograft models is promoted by aneuploidy-driven gene expression deregulation.Oncotarget. 2012 Apr;3(4):399-413. doi: 10.18632/oncotarget.473.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
13 The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.