Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHZCXYB)

• DOT Name: Transmembrane protein 26 (TMEM26)
• Gene Name: TMEM26
• Related Disease:
  Breast cancer
  Breast carcinoma
  Neoplasm
  Obesity
  Asthma
• UniProt ID: TMM26_HUMAN
• Pfam ID: PF09772
• Sequence:
  MEGLVFLNALATRLLFLLHSLVGVWRVTEVKKEPRYWLLALLNLLLFLETALTLKFKRGR
  GYKWFSPAIFLYLISIVPSLWLLELHHETQYCSIQAEGTSQNTSRKEDFNQTLTSNEQTS
  RADDLIETAKVFVNNLSTVCEKVWTLGLHQTFLLMLIIGRWLLPIGGGITRDQLSQLLLM
  FVGTAADILEFTSETLEEQNVRNSPALVYAILVIWTWSMLQFPLDLAVQNVVCPVSVTER
  GFPSLFFCQYSADLWNIGISVFIQDGPFLVVRLILMTYFKVINQMLVFFAAKNFLVVVLQ
  LYRLVVLALAVRASLRSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVT
  SDDSHHTP

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Obesity	DIS47Y1K	Strong	Altered Expression	[2]
Asthma	DISW9QNS	moderate	Genetic Variation	[3]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Transmembrane protein 26 (TMEM26).	[4]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Transmembrane protein 26 (TMEM26).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Transmembrane protein 26 (TMEM26).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transmembrane protein 26 (TMEM26).	[6]

References

• [1] Expression of transmembrane protein 26 (TMEM26) in breast cancer and its association with drug response.Oncotarget. 2016 Jun 21;7(25):38408-38426. doi: 10.18632/oncotarget.9493.
• [2] Trans-anethole ameliorates obesity via induction of browning in white adipocytes and activation of brown adipocytes.Biochimie. 2018 Aug;151:1-13. doi: 10.1016/j.biochi.2018.05.009. Epub 2018 May 24.
• [3] Genome-Wide Association Study Identifies Novel Loci Associated With Diisocyanate-Induced Occupational Asthma.Toxicol Sci. 2015 Jul;146(1):192-201. doi: 10.1093/toxsci/kfv084. Epub 2015 Apr 26.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.