Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI4K6MN)

• DOT Name: Transcription factor Dp family member 3 (TFDP3)
• Synonyms: Cancer/testis antigen 30; CT30; Hepatocellular carcinoma-associated antigen 661
• Gene Name: TFDP3
• Related Disease:
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Testicular cancer
  Advanced cancer
  Autoimmune disease
  Breast cancer
  Breast carcinoma
  Multiple sclerosis
  Neoplasm
  Prostate cancer
  Prostate carcinoma
• UniProt ID: TFDP3_HUMAN
• Pfam ID: PF08781 ; PF02319
• Sequence:
  MAKYVSLTEANEELKVLMDENQTSRPVAVHTSTVNPLGKQLLPKTFGQSSVNIDQQVVIG
  MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWE
  TVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNIKRRTYDALNVLMAMNIISRE
  KKKIKWIGLTTNSAQNCQNLRVERQKRLERIKQKQSELQQLILQQIAFKNLVLRNQYVEE
  QVSQRPLPNSVIHVPFIIISSSKKTVINCSISDDKSEYLFKFNSSFEIHDDTEVLMWMGM
  TFGLESGSCSAEDLKMARNLVPKALEPYVTEMAQGTFGGVFTTAGSRSNGTWLSASDLTN
  IAIGMLATSSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDEDD
• Function: Competitive inhibitor of E2F-mediated transactivation activity. Impairs E2F-mediated cell-cycle progression from G(1) to S phase.
• Tissue Specificity: Predominantly expressed in testis. Low level of expression in pancreas. Highly expressed in ovarian and colon cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[1]
Lung cancer	DISCM4YA	Strong	Altered Expression	[2]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[2]
Testicular cancer	DIS6HNYO	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[4]
Autoimmune disease	DISORMTM	Limited	Altered Expression	[5]
Breast cancer	DIS7DPX1	Limited	Biomarker	[4]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[4]
Multiple sclerosis	DISB2WZI	Limited	Altered Expression	[5]
Neoplasm	DISZKGEW	Limited	Altered Expression	[4]
Prostate cancer	DISF190Y	Limited	Biomarker	[6]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Transcription factor Dp family member 3 (TFDP3).	[7]

References

• [1] TFDP3 Regulates Epithelial-Mesenchymal Transition in Breast Cancer.PLoS One. 2017 Jan 23;12(1):e0170573. doi: 10.1371/journal.pone.0170573. eCollection 2017.
• [2] Possible Molecular Mechanisms for the Roles of MicroRNA-21 Played in Lung Cancer.Technol Cancer Res Treat. 2019 Jan 1;18:1533033819875130. doi: 10.1177/1533033819875130.
• [3] Transduction of dendritic cells with recombinant adenovirus encoding HCA661 activates autologous cytotoxic T lymphocytes to target hepatoma cells.Br J Cancer. 2004 Apr 19;90(8):1636-43. doi: 10.1038/sj.bjc.6601706.
• [4] TFDP3 regulates the apoptosis and autophagy in breast cancer cell line MDA-MB-231.PLoS One. 2018 Sep 20;13(9):e0203833. doi: 10.1371/journal.pone.0203833. eCollection 2018.
• [5] Dipeptidyl peptidase IV (CD26): role in T cell activation and autoimmune disease.Adv Exp Med Biol. 2000;477:155-60. doi: 10.1007/0-306-46826-3_17.
• [6] TFDP3 was expressed in coordination with E2F1 to inhibit E2F1-mediated apoptosis in prostate cancer.Gene. 2014 Mar 10;537(2):253-9. doi: 10.1016/j.gene.2013.12.051. Epub 2014 Jan 7.
• [7] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.