Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIMUS0X)

DOT Name Pro-FMRFamide-related neuropeptide VF (NPVF)
Gene Name NPVF
Related Disease
Analgesia ( )
Gonorrhea ( )
Obesity ( )
Hyperglycemia ( )
UniProt ID
NPVF_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEIISSKLFILLTLATSSLLTSNIFCADELVMSNLHSKENYDKYSEPRGYPKGERSLNFE
ELKDWGPKNVIKMSTPAVNKMPHSFANLPLRFGRNVQEERSAGATANLPLRSGRNMEVSL
VRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQKQSR
RLLFKKIDDAELKQEK
Function
Neuropeptide RFRP-1 acts as a potent negative regulator of gonadotropin synthesis and secretion. Neuropeptides NPSF and NPVF efficiently inhibit forskolin-induced production of cAMP, but RFRP-2 shows no inhibitory activity. Neuropeptide RFRP-1 induces secretion of prolactin in rats. Neuropeptide NPVF blocks morphine-induced analgesia.
Tissue Specificity Isoform 1 is specifically expressed in the retina. Neuropeptides RFRP-1 and NPVF are detected in the hypothalamus.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Analgesia DISK3TVI Strong Biomarker [1]
Gonorrhea DISQ5AO6 Strong Biomarker [2]
Obesity DIS47Y1K Strong Genetic Variation [3]
Hyperglycemia DIS0BZB5 Disputed Biomarker [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Pro-FMRFamide-related neuropeptide VF (NPVF). [5]
------------------------------------------------------------------------------------

References

1 Gonadotropin-inhibitory hormone mediates behavioral stress responses.Gen Comp Endocrinol. 2018 Sep 1;265:202-206. doi: 10.1016/j.ygcen.2018.03.004. Epub 2018 Mar 3.
2 RFRP-3, the mammalian ortholog of GnIH, induces cell cycle arrest at G2/M in porcine ovarian granulosa cells.Peptides. 2018 Mar;101:106-111. doi: 10.1016/j.peptides.2018.01.006. Epub 2018 Jan 11.
3 Sex-Biased Physiological Roles of NPFF1R, the Canonical Receptor of RFRP-3, in Food Intake and Metabolic Homeostasis Revealed by its Congenital Ablation in mice.Metabolism. 2018 Oct;87:87-97. doi: 10.1016/j.metabol.2018.07.003. Epub 2018 Jul 31.
4 RFamide-related peptide-3 promotes alpha TC1 clone 6 cell survival likely via GPR147.Peptides. 2018 Sep;107:39-44. doi: 10.1016/j.peptides.2018.07.009. Epub 2018 Aug 3.
5 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.