Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ16ATH)

• DOT Name: Uncharacterized membrane protein C3orf80 (C3ORF80)
• Gene Name: C3ORF80
• UniProt ID: CC080_HUMAN
• Pfam ID: PF15843
• Sequence:
  MWGPGVTAEGLSVAPAPPPLLPLLLLLALALVAPSRGGGGCAELACGERERCCDATNATA
  VRCCKLPLHAFLDNVGWFVRKLSGLLILLVLFAIGYFLQRIICPSPRRYPRGQARPGQRP
  GPPGGAGPLGGAGPPDDDDDSPALLRDEAAAGSQDSLLDSGGGGRGRGGGGRSDPSCASE
  HEMRVVSPVFLQLPSYEEVKYLPTYEESMRLQQLSPGEVVLPVSVLGRPRGGVAAEPDGG
  EGRYPLI

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Uncharacterized membrane protein C3orf80 (C3ORF80).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Uncharacterized membrane protein C3orf80 (C3ORF80).	[2]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Uncharacterized membrane protein C3orf80 (C3ORF80).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Uncharacterized membrane protein C3orf80 (C3ORF80).	[4]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Uncharacterized membrane protein C3orf80 (C3ORF80).	[5]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Uncharacterized membrane protein C3orf80 (C3ORF80).	[6]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of Uncharacterized membrane protein C3orf80 (C3ORF80).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Uncharacterized membrane protein C3orf80 (C3ORF80).	[8]

References

• [1] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [4] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [5] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [6] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [7] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.