Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ4ZWF2)

DOT Name	Small proline-rich protein 2F (SPRR2F)
Synonyms	SPR-2F
Gene Name	SPRR2F
UniProt ID	SPR2F_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF14820
Sequence	MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPS PPCQPKCPPKSK
Function	Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Reactome Pathway	Formation of the cornified envelope (R-HSA-6809371 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Small proline-rich protein 2F (SPRR2F).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Small proline-rich protein 2F (SPRR2F).	[4]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Small proline-rich protein 2F (SPRR2F).	[2]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Small proline-rich protein 2F (SPRR2F).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Small proline-rich protein 2F (SPRR2F).	[5]
------------------------------------------------------------------------------------

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
3	Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
5	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.