Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ55M30)

DOT Name Stomatin-like protein 2, mitochondrial (STOML2)
Synonyms SLP-2; EPB72-like protein 2; Paraprotein target 7; Paratarg-7
Gene Name STOML2
UniProt ID
STML2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01145 ; PF16200
Sequence
MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVKMS
Function
Mitochondrial protein that probably regulates the biogenesis and the activity of mitochondria. Stimulates cardiolipin biosynthesis, binds cardiolipin-enriched membranes where it recruits and stabilizes some proteins including prohibitin and may therefore act in the organization of functional microdomains in mitochondrial membranes. Through regulation of the mitochondrial function may play a role into several biological processes including cell migration, cell proliferation, T-cell activation, calcium homeostasis and cellular response to stress. May play a role in calcium homeostasis through negative regulation of calcium efflux from mitochondria. Required for mitochondrial hyperfusion a pro-survival cellular response to stress which results in increased ATP production by mitochondria. May also regulate the organization of functional domains at the plasma membrane and play a role in T-cell activation through association with the T-cell receptor signaling complex and its regulation.
Tissue Specificity Ubiquitously expressed at low levels. Expressed in lymphoid tissues (at protein level).
Reactome Pathway
Processing of SMDT1 (R-HSA-8949664 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [1]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [3]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [4]
Selenium DM25CGV Approved Selenium increases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [5]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [6]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [7]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [8]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [9]
AHPN DM8G6O4 Investigative AHPN decreases the expression of Stomatin-like protein 2, mitochondrial (STOML2). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
2 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
6 Poly(ADP-ribose) glycohydrolase silencing down-regulates TCTP and Cofilin-1 associated with metastasis in benzo(a)pyrene carcinogenesis. Am J Cancer Res. 2014 Dec 15;5(1):155-67. eCollection 2015.
7 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
8 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
9 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
10 ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.