Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK43GE4)

DOT Name Psoriasis susceptibility 1 candidate gene 2 protein (PSORS1C2)
Synonyms Protein SPR1
Gene Name PSORS1C2
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Major depressive disorder ( )
Neoplasm ( )
Plasma cell myeloma ( )
Psoriasis ( )
Schizophrenia ( )
Systemic sclerosis ( )
UniProt ID
PS1C2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15356
Sequence
MILNWKLLGILVLCLHTRGISGSEGHPSHPPAEDREEAGSPTLPQGPPVPGDPWPGAPPL
FEDPPPTRPSRPWRDLPETGVWLPEPPRTDPPQPPRPDDPWPAGPQPPENPWPPAPEVDN
RPQEEPDLDPPREEYR
Tissue Specificity Expressed in skin. Also expressed in heart and skeletal muscle.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Altered Expression [1]
Breast carcinoma DIS2UE88 Strong Altered Expression [1]
Breast neoplasm DISNGJLM Strong Altered Expression [1]
Major depressive disorder DIS4CL3X Strong Genetic Variation [2]
Neoplasm DISZKGEW Strong Altered Expression [1]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [3]
Psoriasis DIS59VMN Strong Genetic Variation [4]
Schizophrenia DISSRV2N Strong Genetic Variation [2]
Systemic sclerosis DISF44L6 Strong Genetic Variation [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Psoriasis susceptibility 1 candidate gene 2 protein (PSORS1C2). [6]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Psoriasis susceptibility 1 candidate gene 2 protein (PSORS1C2). [7]
------------------------------------------------------------------------------------

References

1 Re-expression of SPR1 in breast cancer cells by phorbol 12-myristate 13-acetate (PMA) or UV irradiation is mediated by the AP-1 binding site in the SPR1 promoter.Mol Med. 1999 Aug;5(8):526-41.
2 Bivariate genome-wide association analyses of the broad depression phenotype combined with major depressive disorder, bipolar disorder or schizophrenia reveal eight novel genetic loci for depression.Mol Psychiatry. 2020 Jul;25(7):1420-1429. doi: 10.1038/s41380-018-0336-6. Epub 2019 Jan 9.
3 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.Nat Genet. 2013 Oct;45(10):1221-1225. doi: 10.1038/ng.2733. Epub 2013 Aug 18.
4 Correlation of HLA-Cw*06 allele frequency with some clinical features of psoriasis vulgaris in the population of northern Poland.J Appl Genet. 2004;45(4):473-6.
5 Genome-wide scan identifies TNIP1, PSORS1C1, and RHOB as novel risk loci for systemic sclerosis.PLoS Genet. 2011 Jul;7(7):e1002091. doi: 10.1371/journal.pgen.1002091. Epub 2011 Jul 7.
6 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.