Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK73MCA)

DOT Name Cilia- and flagella-associated protein 69 (CFAP69)
Gene Name CFAP69
Related Disease
B-cell neoplasm ( )
Male infertility ( )
Obsolete non-syndromic male infertility due to sperm motility disorder ( )
Spermatogenic failure 24 ( )
UniProt ID
CFA69_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF21049
Sequence
MWTEEAGATAEAQESGIRNKSSSSSQIPVVGVVTEDDEAQDVFKPMDLNRVIKLLEETDK
DGLEEKQLKFVKKLVQCYQNGLPLRDLAQIFKILNLCSGKIKNQPRFIESAYDIIKLCGL
PFLKKKVSDEITYAEDTANSIALLGDLMKIPSSELRIQICKCIVDFYHAEPPKKHIPGYQ
QASSSYKIQMAEVGGLAKTMVQSMTLLENQLVEKLWVLKVLQHLSTSEVNCTIMMKAQAA
SGICTHLNDPDPSGQLLFRSSEILWNLLEKSSKEEVIQQLSNLECLLALKEVFKNLFMRG
FSHYDRQLRNDILVITTIIAQNPEAPMIECGFTKDLILFATFNEVKSQNLLVKGLKLSNS
YEDFELKKLLFNVIVILCKDLPTVQLLIDGKVILALFTYVKKPEKQKIIDWSAAQHEELQ
LHAIATLSSVAPLLIEEYMSCQGNARVLAFLEWCESEDPFFSHGNSFHGTGGRGNKFAQM
RYSLRLLRAVVYLEDETVNKDLCEKGTIQQMIGIFKNIISKPNEKEEAIVLEIQSDILLI
LSGLCENHIQRKEIFGTEGVDIVLHVMKTDPRKLQSGLGYNVLLFSTLDSIWCCILGCYP
SEDYFLEKEGIFLLLDLLALNQKKFCNLILGIMVEFCDNPKTAAHVNAWQGKKDQTAASL
LIKLWRKEEKELGVKRDKNGKIIDTKKPLFTSFQEEQKIIPLPANCPSIAVMDVSENIRA
KIYAILGKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWNEIYEEIKLEKLRPVTTDKK
ALEAITTASENIGKMVASLQSDIIESQACQDMQNEQKVYAKIQATHKQRELANKSWEDFL
ARTSNAKTLKKAKSLQEKAIEASRYHKRPQNAIFHQTHIKGLNTTVPSGGVVTVESTPAR
LVGGPLVDTDIALKKLPIRGGALQRVKAVKIVDAPKKSIPT
Function
Cilium- and flagellum-associated protein. In the olfactory epithelium, regulates the speed of activation and termination of the odor response and thus contributes to the robustness of olfactory transduction pathways. Required for sperm flagellum assembly and stability.
Tissue Specificity Highly expressed in the testis, specifically in sperm (at protein level) . Expressed in the brain, kidney, liver, lung, and intestine .

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
B-cell neoplasm DISVY326 Definitive Posttranslational Modification [1]
Male infertility DISY3YZZ Strong Biomarker [2]
Obsolete non-syndromic male infertility due to sperm motility disorder DISG7641 Supportive Autosomal recessive [2]
Spermatogenic failure 24 DISMTKPZ Limited Autosomal recessive [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Cilia- and flagella-associated protein 69 (CFAP69). [4]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cilia- and flagella-associated protein 69 (CFAP69). [5]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Cilia- and flagella-associated protein 69 (CFAP69). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Cilia- and flagella-associated protein 69 (CFAP69). [7]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Cilia- and flagella-associated protein 69 (CFAP69). [8]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Cilia- and flagella-associated protein 69 (CFAP69). [9]
Testosterone DM7HUNW Approved Testosterone increases the expression of Cilia- and flagella-associated protein 69 (CFAP69). [9]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Cilia- and flagella-associated protein 69 (CFAP69). [10]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Cilia- and flagella-associated protein 69 (CFAP69). [12]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Cilia- and flagella-associated protein 69 (CFAP69). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Cilia- and flagella-associated protein 69 (CFAP69). [11]
------------------------------------------------------------------------------------

References

1 DNA methylation profiles in diffuse large B-cell lymphoma and their relationship to gene expression status.Leukemia. 2008 May;22(5):1035-43. doi: 10.1038/leu.2008.18. Epub 2008 Feb 21.
2 Absence of CFAP69 Causes Male Infertility due to Multiple Morphological Abnormalities of the Flagella in Human and Mouse. Am J Hum Genet. 2018 Apr 5;102(4):636-648. doi: 10.1016/j.ajhg.2018.03.007.
3 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
4 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
5 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
9 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
10 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
13 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.