Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK7QZ3B)

DOT Name Leucine-rich repeat and fibronectin type-III domain-containing protein 5 (LRFN5)
Gene Name LRFN5
Related Disease
Autism ( )
Autism spectrum disorder ( )
Major depressive disorder ( )
Pervasive developmental disorder ( )
Prion disease ( )
Myopia ( )
UniProt ID
LRFN5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5XNP; 5XNQ; 5XWS; 5XWT
Pfam ID
PF13927 ; PF13855
Sequence
MEKILFYLFLIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDH
NMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLE
GQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIAS
NPAGEATQIVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKLSQDK
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLAAGT
MYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVAS
VLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTNGAQIQGCSVTLPQSVSKQAVGHEENA
QCCKATSDNVIQSSETCSSQDSSTTTSALPPSWTSSTSVSQKQKRKTGTKPSTEPQNEAV
TNVESQNTNRNNSTALQLASRPPDSVTEGPTSKRAHIKPNALLTNVDQIVQETQRLELI
Function Cell adhesion molecule that mediates homophilic cell-cell adhesion in a Ca(2+)-independent manner. Promotes neurite outgrowth in hippocampal neurons.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autism DISV4V1Z Strong Biomarker [1]
Autism spectrum disorder DISXK8NV Strong Altered Expression [2]
Major depressive disorder DIS4CL3X Strong Biomarker [3]
Pervasive developmental disorder DIS51975 Strong Altered Expression [2]
Prion disease DISOUMB0 Strong Biomarker [4]
Myopia DISK5S60 Limited Genetic Variation [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 (LRFN5). [6]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 (LRFN5). [7]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 (LRFN5). [8]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 (LRFN5). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 (LRFN5). [11]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 (LRFN5). [10]
------------------------------------------------------------------------------------

References

1 Structural basis of SALM5-induced PTP dimerization for synaptic differentiation.Nat Commun. 2018 Jan 18;9(1):268. doi: 10.1038/s41467-017-02414-2.
2 Microdeletion of pseudogene chr14.232.a affects LRFN5 expression in cells of a patient with autism spectrum disorder.Eur J Hum Genet. 2019 Sep;27(9):1475-1480. doi: 10.1038/s41431-019-0430-5. Epub 2019 May 31.
3 Identification of novel common variants associated with chronic pain using conditional false discovery rate analysis with major depressive disorder and assessment of pleiotropic effects of LRFN5.Transl Psychiatry. 2019 Nov 20;9(1):310. doi: 10.1038/s41398-019-0613-4.
4 Gene expression profiling on sheep brain reveals differential transcripts in scrapie-affected/not-affected animals.Brain Res. 2007 Apr 20;1142:217-22. doi: 10.1016/j.brainres.2007.01.033. Epub 2007 Jan 17.
5 Detection and interpretation of shared genetic influences on 42 human traits.Nat Genet. 2016 Jul;48(7):709-17. doi: 10.1038/ng.3570. Epub 2016 May 16.
6 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
7 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
8 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
9 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.