Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKDPZD4)

• DOT Name: Transmembrane protein 31 (TMEM31)
• Gene Name: TMEM31
• Related Disease:
  Advanced cancer
  Metastatic melanoma
  Testicular cancer
  Melanoma
• UniProt ID: TMM31_HUMAN
• Sequence:
  MRLTEKSEGEQQLKPNNSNAPNEDQEEEIQQSEQHTPARQRTQRADTQPSRCRLPSRRTP
  TTSSDRTINLLEVLPWPTEWIFNPYRLPALFELYPEFLLVFKEAFHDISHCLKAQMEKIG
  LPIILHLFALSTLYFYKFFLPTILSLSFFILLVLLLLLFIIVFILIFF

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Metastatic melanoma	DISSL43L	Strong	Altered Expression	[2]
Testicular cancer	DIS6HNYO	Strong	Biomarker	[2]
Melanoma	DIS1RRCY	Limited	Biomarker	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transmembrane protein 31 (TMEM31).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Transmembrane protein 31 (TMEM31).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Transmembrane protein 31 (TMEM31).	[4]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Transmembrane protein 31 (TMEM31).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Transmembrane protein 31 (TMEM31).	[8]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Transmembrane protein 31 (TMEM31).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Transmembrane protein 31 (TMEM31).	[7]

References

• [1] In silico analysis of transmembrane protein 31 (TMEM31) antigen to design novel multiepitope peptide and DNA cancer vaccines against melanoma.Mol Immunol. 2019 Aug;112:93-102. doi: 10.1016/j.molimm.2019.04.030. Epub 2019 May 9.
• [2] Expression of novel cancer/testis antigen TMEM31 increases during metastatic melanoma progression.Oncol Lett. 2017 Apr;13(4):2269-2273. doi: 10.3892/ol.2017.5728. Epub 2017 Feb 13.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.