Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL628I1)

DOT Name Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2)
Synonyms Estrogen-induced gene 121-like protein; hEIG121L
Gene Name ELAPOR2
UniProt ID
ELAP2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLFRARGPVRGRGWGRPAEAPRRGRSPPWSPAWICCWALAGCQAAWAGDLPSSSSRPLPP
CQEKDYHFEYTECDSSGSRWRVAIPNSAVDCSGLPDPVRGKECTFSCASGEYLEMKNQVC
SKCGEGTYSLGSGIKFDEWDELPAGFSNIATFMDTVVGPSDSRPDGCNNSSWIPRGNYIE
SNRDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFFIQNDQCQEMDTTTDKWVKLTDN
GEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTFSN
KPGSFNCQVCPRNTYSEKGAKECIRCKDDSQFSEEGSSECTERPPCTTKDYFQIHTPCDE
EGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTFSD
GTKECRPCPAGTEPALGFEYKWWNVLPGNMKTSCFNVGNSKCDGMNGWEVAGDHIQSGAG
GSDNDYLILNLHIPGFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNV
VESWGGTKEKQAYTHIIFKNATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGV
ASSCRACALGSEQSGSSCVPCPPGHYIEKETNQCKECPPDTYLSIHQVYGKEACIPCGPG
SKNNQDHSVCYSDCFFYHEKENQSLHYDFSNLSSVGSLMNGPSFTSKGTKYFHFFNISLC
GHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSII
LADTFIGVTVETTLKNINIKEDMFPVPTSQIPDVHFFYKSSTATTSCINGRSTAVKMRCN
PTKSGAGVISVPSKCPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACKRGFQETLYV
WNEPKWCIKGISLPEKKLATCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKY
SKLVMTTNSKECELPAADSCAIMEGEDNEEEVVYSNKQSLLGKLKSLATKEKEDHFESVQ
LKTSRSPNI
Function Functions as a regulator of the BMP signaling pathway and may be involved in epidermal differentiation.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [4]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [5]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [6]
Sulindac DM2QHZU Approved Sulindac increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the mutagenesis of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [8]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [10]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 (ELAPOR2). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
6 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
7 Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
8 Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
9 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
11 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.