Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLUI3PV)

DOT Name Insulin-like peptide INSL5 (INSL5)
Synonyms Insulin-like peptide 5
Gene Name INSL5
Related Disease
Type-1/2 diabetes ( )
Insulinoma ( )
Neuroendocrine neoplasm ( )
Obesity ( )
Polycystic ovarian syndrome ( )
UniProt ID
INSL5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2K1V; 2KBC; 7YJ4
Pfam ID
PF00049
Sequence
MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAE
TGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTL
CCTDGCSMTDLSALC
Function May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor.
Tissue Specificity Highly expressed in rectum with lower levels in uterus and ascending and descending colon.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )
Relaxin sig.ling pathway (hsa04926 )
Reactome Pathway
Relaxin receptors (R-HSA-444821 )
G alpha (i) signalling events (R-HSA-418594 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Type-1/2 diabetes DISIUHAP Definitive Biomarker [1]
Insulinoma DISIU1JS Strong Biomarker [2]
Neuroendocrine neoplasm DISNPLOO Strong Biomarker [3]
Obesity DIS47Y1K moderate Biomarker [4]
Polycystic ovarian syndrome DISZ2BNG moderate Altered Expression [5]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Insulin-like peptide INSL5 (INSL5). [6]
------------------------------------------------------------------------------------

References

1 Engineering of chimeric peptides as antagonists for the G protein-coupled receptor, RXFP4.Sci Rep. 2019 Nov 28;9(1):17828. doi: 10.1038/s41598-019-53707-z.
2 Signal transduction pathways activated by insulin-like peptide 5 at the relaxin family peptide RXFP4 receptor.Br J Pharmacol. 2017 May;174(10):1077-1089. doi: 10.1111/bph.13522. Epub 2016 Jul 13.
3 INSL5 may be a unique marker of colorectal endocrine cells and neuroendocrine tumors.Biochem Biophys Res Commun. 2013 Mar 22;432(4):586-92. doi: 10.1016/j.bbrc.2013.02.042. Epub 2013 Feb 22.
4 Insulin-like peptide 5 fails to improve metabolism or body weight in obese mice.Peptides. 2019 Oct;120:170116. doi: 10.1016/j.peptides.2019.170116. Epub 2019 Jul 23.
5 Circulating insulin-like peptide 5 levels and its association with metabolic and hormonal parameters in women with polycystic ovary syndrome.J Endocrinol Invest. 2019 Mar;42(3):303-312. doi: 10.1007/s40618-018-0917-x. Epub 2018 Jun 28.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.