Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMA5FLK)

• DOT Name: Sorting nexin-24 (SNX24)
• Gene Name: SNX24
• UniProt ID: SNX24_HUMAN
• PDB ID: 4AZ9
• Pfam ID: PF00787
• Sequence:
  MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPS
  KHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDET
  ESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR
• Function: May be involved in several stages of intracellular trafficking.

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Sorting nexin-24 (SNX24).	[1]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Sorting nexin-24 (SNX24).	[2]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Sorting nexin-24 (SNX24).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Sorting nexin-24 (SNX24).	[4]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Sorting nexin-24 (SNX24).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Sorting nexin-24 (SNX24).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Sorting nexin-24 (SNX24).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Sorting nexin-24 (SNX24).	[8]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Sorting nexin-24 (SNX24).	[9]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Sorting nexin-24 (SNX24).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [3] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [4] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [5] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [9] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [10] Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.