Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMAF0NU)

• DOT Name: Uncharacterized protein C14orf28 (C14ORF28)
• Synonyms: Dopamine receptor-interacting protein 1
• Gene Name: C14ORF28
• Related Disease:
  Advanced cancer
  Bipolar disorder
  Colorectal carcinoma
• UniProt ID: CN028_HUMAN
• Sequence:
  MKTLFEEIKASIKNNYNQDRSFCRPVLPWGGVFTIKAGRKAVSCTPLYVEIRLKNTCTID
  GFLMLLYVILNENENFPRELSLHFGREFVDCFLYLMDTYSFTTVKLLWIWDKMEKQQYKS
  EVHKASLIIDLFGNEHDNFTKNLENLMSTIQESYCSNWRCPTRVQEDQQRTININPPQEI
  PHGNLIRLAVNELFCSKIELCEEHGCGGLREFSQRIFCHGAPPFVVLNMQHWKSEDLAYV
  PYYLDLSDHKYLLEGATLFNKEEHHYSAAFQIGGHWMHYDGLRNVNLILLNKPPEFLLLS
  SLVYIRATEK

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[2]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Uncharacterized protein C14orf28 (C14ORF28).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Uncharacterized protein C14orf28 (C14ORF28).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Uncharacterized protein C14orf28 (C14ORF28).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Uncharacterized protein C14orf28 (C14ORF28).	[6]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Uncharacterized protein C14orf28 (C14ORF28).	[7]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Uncharacterized protein C14orf28 (C14ORF28).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Uncharacterized protein C14orf28 (C14ORF28).	[10]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Uncharacterized protein C14orf28 (C14ORF28).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Uncharacterized protein C14orf28 (C14ORF28).	[9]

References

• [1] C14orf28 downregulated by miR-519d contributes to oncogenicity and regulates apoptosis and EMT in colorectal cancer.Mol Cell Biochem. 2017 Oct;434(1-2):197-208. doi: 10.1007/s11010-017-3049-2. Epub 2017 Apr 28.
• [2] Altered expression and coregulation of dopamine signalling genes in schizophrenia and bipolar disorder.Neuropathol Appl Neurobiol. 2011 Feb;37(2):206-19. doi: 10.1111/j.1365-2990.2010.01128.x.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [8] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.