Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMGCWWB)

• DOT Name: RNA binding motif protein, X-linked-like-1 (RBMXL1)
• Synonyms: Heterogeneous nuclear ribonucleoprotein G-like 1
• Gene Name: RBMXL1
• Related Disease:
  Primary hyperoxaluria
  Advanced cancer
  Crohn disease
  leukaemia
  Leukemia
  Neoplasm
  Ulcerative colitis
  Von hippel-lindau disease
• UniProt ID: RMXL1_HUMAN
• Pfam ID: PF08081 ; PF00076
• Sequence:
  MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPA
  DAKDAARDMNGKSLDGKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFGAGRGGSGGTR
  GPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPSPKRSAPSGLVRSSSGMGGR
  APLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
  YTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPLTRGP
  PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSCDRVGRQERGLPPSVERGYPSSR
  DSYSSSSRGAPRGAGPGGSRSDRGGGRSRY
• Function: RNA-binding protein which may be involved in pre-mRNA splicing.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Primary hyperoxaluria	DIS0L16N	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Crohn disease	DIS2C5Q8	Strong	Altered Expression	[3]
leukaemia	DISS7D1V	Strong	Biomarker	[4]
Leukemia	DISNAKFL	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[5]
Ulcerative colitis	DIS8K27O	Strong	Altered Expression	[3]
Von hippel-lindau disease	DIS6ZFQQ	Strong	Genetic Variation	[5]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of RNA binding motif protein, X-linked-like-1 (RBMXL1).	[6]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of RNA binding motif protein, X-linked-like-1 (RBMXL1).	[7]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of RNA binding motif protein, X-linked-like-1 (RBMXL1).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of RNA binding motif protein, X-linked-like-1 (RBMXL1).	[9]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of RNA binding motif protein, X-linked-like-1 (RBMXL1).	[10]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of RNA binding motif protein, X-linked-like-1 (RBMXL1).	[10]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of RNA binding motif protein, X-linked-like-1 (RBMXL1).	[12]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of RNA binding motif protein, X-linked-like-1 (RBMXL1).	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of RNA binding motif protein, X-linked-like-1 (RBMXL1).	[11]

References

• [1] Metabolism of Oxalate in Humans: A Potential Role Kynurenine Aminotransferase/Glutamine Transaminase/Cysteine Conjugate Betalyase Plays in Hyperoxaluria.Curr Med Chem. 2019;26(26):4944-4963. doi: 10.2174/0929867326666190325095223.
• [2] Differentiation Therapy Targeting the -Catenin/CBP Interaction in Pancreatic Cancer.Cancers (Basel). 2018 Mar 29;10(4):95. doi: 10.3390/cancers10040095.
• [3] Increased expression of kynurenine aminotransferases mRNA in lymphocytes of patients with inflammatory bowel disease.Therap Adv Gastroenterol. 2019 Oct 19;12:1756284819881304. doi: 10.1177/1756284819881304. eCollection 2019.
• [4] Hypoxia selects for a quiescent, CML stem/leukemia initiating-like population dependent on CBP/catenin transcription.Curr Mol Pharmacol. 2013 Nov;6(3):204-10. doi: 10.2174/1874467207666140219121219.
• [5] Blockade of the vascular endothelial growth factor-receptor 2 pathway inhibits the growth of human renal cell carcinoma, RBM1-IT4, in the kidney but not in the bone of nude mice.Int J Oncol. 2007 Apr;30(4):937-45.
• [6] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [7] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [8] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [12] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [13] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.